Superfamily : 81464 [ Cytochrome c oxidase subunit II-like, transmembrane region ]
Class : Membrane and cell surface proteins and peptides
Fold : Transmembrane helix hairpin
# of Members : 4
solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x
beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x
hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x
 
                             10        20        30        40        50  
d3s8gb1  (   3 )                      dekahailayekgwlafslamlfv-fialiay
d6pw1b1  (  30 )    leiigrpqpggtgfq----psaspvatqihwldgfilviiaaitifvtll
d6wtib1  (  24 )                gcnsalldpkgqigleqrsliltafglmlivvipailm
d7cohb1  (   2 )          aypmqlgfq----dAtspimeellhfhdhtlmivflisslvlyi
                                           aaaaaaaaaaaaaaaaaaaaaaaaaaa

                             60        70        80        90        100 
d3s8gb1  (  36 )    tlath                                             
d6pw1b1  (  76 )    ilyavwrfhekrnk-vpar-fthnspleiawtivpivilvaigafslpvl
d6wtib1  (  62 )    avgfawkyrasnkdakyspnwshsnkveavvwtvpiliiiflavltwktt
d7cohb1  (  42 )    islmltt------k-lthtstmdaqevetiwtilpaiililialpslrIl
                    aaaa                    aaaaaaaaaaaaaaaaaaaaaaaaaa

                          
d3s8gb1                   
d6pw1b1  ( 124 )    fnqqei
d6wtib1  ( 112 )    haleps
d7cohb1  (  85 )    ymmdei
                    aa    

 

 

Domain IDNameFamilySourceDomainSTRING-DB
Bacterial ba3 type cytochrome c oxidase subunit IICytochrome c oxidase subunit II-like, transmembrane regionThermus thermophilus [TaxId: 274]view
automated matchesCytochrome c oxidase subunit II-like, transmembrane regionRhodobacter sphaeroides [TaxId: 272943]view
Cytochrome O ubiquinol oxidase, subunit IICytochrome c oxidase subunit II-like, transmembrane regionEscherichia coli [TaxId: 562]view
Mitochondrial cytochrome c oxidase, subunit IICytochrome c oxidase subunit II-like, transmembrane regionCow (Bos taurus) [TaxId: 9913]view

 

No outliers

FeatureDownload
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

 

10 20 30 40 50 60 70 80 90 100
- - - - - - - - - - - - - - - - - - D E K A H A I L A Y E K G W L A F S L A M L F V - F I A L I A Y T L A T H - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
L E I I G R P Q P G G T G F Q - - - - P S A S P V A T Q I H W L D G F I L V I I A A I T I F V T L L I L Y A V W R F H E K R N K - V P A R - F T H N S P L E I A W T I V P I V I L V A I G A F S L P V L F N Q Q E I
- - - - - - - - - - - - G C N S A L L D P K G Q I G L E Q R S L I L T A F G L M L I V V I P A I L M A V G F A W K Y R A S N K D A K Y S P N W S H S N K V E A V V W T V P I L I I I F L A V L T W K T T H A L E P S
- - - - - - A Y P M Q L G F Q - - - - D A T S P I M E E L L H F H D H T L M I V F L I S S L V L Y I I S L M L T T - - - - - - K - L T H T S T M D A Q E V E T I W T I L P A I I L I L I A L P S L R I L Y M M D E I

 

 

 

 

 

Member Chain UniProtKB GO term