Superfamily : 81333 [ Rotary ATPase ring subunits ]
Class : Membrane and cell surface proteins and peptides
Fold : Transmembrane helix hairpin
# of Members : 3
solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x
beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x
hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x
 
                             10        20        30        40        50  
d6m0rd1  (   7 )    sniyaplyapffgfagcaaamvlsclgaaigtaksgigiagigtfkpeli
d6m0rd2  (  90 )         ytlfngfmhlscglcvgfaclssgyaigmvgdvGvrkymhqprlf
d6oqri-  (   3 )          nlnmdllymaaavmmglaaigaaigigilggkflegaarqpdli
                            aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa    333 

                             60        70        80      
d6m0rd1  (  57 )    m----kslipvvmsgilaiyglvvavliagnlspted
d6m0rd2  ( 135 )    v----givlilifsevlglygmivalilntrGs    
d6oqri-  (  47 )    pllrtqffivmglvdaipmiavglGlyvmfavA    
                            aaaaaaaaaaaaaaaaaaaaaa       

 

 

Domain IDNameFamilySourceDomainSTRING-DB
automated matchesF1F0 ATP synthase subunit C or V-type proton ATPase subunit cBaker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]view
automated matchesautomated matchesBaker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]view
automated matchesF1F0 ATP synthase subunit C or V-type proton ATPase subunit cEscherichia coli [TaxId: 562]view

 

No outliers

FeatureDownload
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

 

10 20 30 40 50 60 70 80
S N I Y A P L Y A P F F G F A G C A A A M V L S C L G A A I G T A K S G I G I A G I G T F K P E L I M - - - - K S L I P V V M S G I L A I Y G L V V A V L I A G N L S P T E D
- - - - - Y T L F N G F M H L S C G L C V G F A C L S S G Y A I G M V G D V G V R K Y M H Q P R L F V - - - - G I V L I L I F S E V L G L Y G M I V A L I L N T R G S - - - -
- - - - - - N L N M D L L Y M A A A V M M G L A A I G A A I G I G I L G G K F L E G A A R Q P D L I P L L R T Q F F I V M G L V D A I P M I A V G L G L Y V M F A V A - - - -

 

 

 

 

 

Member Chain UniProtKB GO term