PASS2.8 - Home

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x

beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x

hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x

                             10        20        30        40        50  
d3rkoa-  (  15 )     afaiflivaiglcclmlvggwflggrararlrlsakfylvamffvifdv
d4he8a-  (   1 )    mapiqeyvgtliyvgvalfigvaallvga-lkrfpvhfyvvamlfilfdv
                        aaaaaaaaaaaaaaaaaaaaaaaa     aaaaaaaaaaaaaaaaa

                             60        70        80        90     
d3rkoa-  (  81 )    ealylfawstsiresgwvgfveaaififvllaglvylvrigAldwt
d4he8a-  (  74 )    evaflwpyavsagglglygflgvlaftlllfvgflyewwkgvm   
                    aaaaaaaaaa     aaaaaaaaaaaaaaaaaaaaaaaa

Domains
Outliers

Domain ID	Name	Family	Source	Domain	STRING-DB
d3rkoa- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3rkoa- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	NADH-quinone oxidoreductase subunit A, NuoA/Nqo7	Respiratory complex I subunit NuoA-like	Escherichia coli [TaxId: 562]		view
d4he8a- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4he8a- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	NADH-quinone oxidoreductase subunit A, NuoA/Nqo7	Respiratory complex I subunit NuoA-like	Thermus thermophilus HB8 [TaxId: 300852]		view

No outliers

Feature	Download
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

									10										20										30										40										50										60										70										80										90
-	A	F	A	I	F	L	I	V	A	I	G	L	C	C	L	M	L	V	G	G	W	F	L	G	G	R	A	R	A	R	L	R	L	S	A	K	F	Y	L	V	A	M	F	F	V	I	F	D	V	E	A	L	Y	L	F	A	W	S	T	S	I	R	E	S	G	W	V	G	F	V	E	A	A	I	F	I	F	V	L	L	A	G	L	V	Y	L	V	R	I	G	A	L	D	W	T
M	A	P	I	Q	E	Y	V	G	T	L	I	Y	V	G	V	A	L	F	I	G	V	A	A	L	L	V	G	A	-	L	K	R	F	P	V	H	F	Y	V	V	A	M	L	F	I	L	F	D	V	E	V	A	F	L	W	P	Y	A	V	S	A	G	G	L	G	L	Y	G	F	L	G	V	L	A	F	T	L	L	L	F	V	G	F	L	Y	E	W	W	K	G	V	M	-	-	-

Member	Chain	UniProtKB	GO term

									10										20										30										40										50										60										70										80										90
-	A	F	A	I	F	L	I	V	A	I	G	L	C	C	L	M	L	V	G	G	W	F	L	G	G	R	A	R	A	R	L	R	L	S	A	K	F	Y	L	V	A	M	F	F	V	I	F	D	V	E	A	L	Y	L	F	A	W	S	T	S	I	R	E	S	G	W	V	G	F	V	E	A	A	I	F	I	F	V	L	L	A	G	L	V	Y	L	V	R	I	G	A	L	D	W	T
M	A	P	I	Q	E	Y	V	G	T	L	I	Y	V	G	V	A	L	F	I	G	V	A	A	L	L	V	G	A	-	L	K	R	F	P	V	H	F	Y	V	V	A	M	L	F	I	L	F	D	V	E	V	A	F	L	W	P	Y	A	V	S	A	G	G	L	G	L	Y	G	F	L	G	V	L	A	F	T	L	L	L	F	V	G	F	L	Y	E	W	W	K	G	V	M	-	-	-

									10										20										30										40										50										60										70										80										90
-	A	F	A	I	F	L	I	V	A	I	G	L	C	C	L	M	L	V	G	G	W	F	L	G	G	R	A	R	A	R	L	R	L	S	A	K	F	Y	L	V	A	M	F	F	V	I	F	D	V	E	A	L	Y	L	F	A	W	S	T	S	I	R	E	S	G	W	V	G	F	V	E	A	A	I	F	I	F	V	L	L	A	G	L	V	Y	L	V	R	I	G	A	L	D	W	T
M	A	P	I	Q	E	Y	V	G	T	L	I	Y	V	G	V	A	L	F	I	G	V	A	A	L	L	V	G	A	-	L	K	R	F	P	V	H	F	Y	V	V	A	M	L	F	I	L	F	D	V	E	V	A	F	L	W	P	Y	A	V	S	A	G	G	L	G	L	Y	G	F	L	G	V	L	A	F	T	L	L	L	F	V	G	F	L	Y	E	W	W	K	G	V	M	-	-	-

									10										20										30										40										50										60										70										80										90
-	A	F	A	I	F	L	I	V	A	I	G	L	C	C	L	M	L	V	G	G	W	F	L	G	G	R	A	R	A	R	L	R	L	S	A	K	F	Y	L	V	A	M	F	F	V	I	F	D	V	E	A	L	Y	L	F	A	W	S	T	S	I	R	E	S	G	W	V	G	F	V	E	A	A	I	F	I	F	V	L	L	A	G	L	V	Y	L	V	R	I	G	A	L	D	W	T
M	A	P	I	Q	E	Y	V	G	T	L	I	Y	V	G	V	A	L	F	I	G	V	A	A	L	L	V	G	A	-	L	K	R	F	P	V	H	F	Y	V	V	A	M	L	F	I	L	F	D	V	E	V	A	F	L	W	P	Y	A	V	S	A	G	G	L	G	L	Y	G	F	L	G	V	L	A	F	T	L	L	L	F	V	G	F	L	Y	E	W	W	K	G	V	M	-	-	-