PASS2.8 - Home

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x

beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x

hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x

                             10        20        30        40        50  
d1egwa-  (   2 )    g---rkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifn
d1mnma-  (  15 )    qkerrkiei-fienktrrhvtfskrkhgimkkafelsvltgtqvlllvvs
                                  aaaaaaaaaaaaaaaaaaaaaaaaa     bbbbb 

                             60        70        80   
d1egwa-  (  50 )    ssnklfqyastmvlky-tey              
d1mnma-  (  65 )    etglvytfStpkfepivtqegrnliqaclnapdd
                        bbbbb

Domains
Outliers

Domain ID	Name	Family	Source	Domain	STRING-DB
d1egwa- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1egwa- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Myocyte enhancer factor Mef2a core	SRF-like	Human (Homo sapiens) [TaxId: 9606]		view
d1mnma- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1mnma- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	MCM1 transcriptional regulator	SRF-like	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]		view

No outliers

Feature	Download
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

									10										20										30										40										50										60										70										80
G	-	-	-	R	K	I	Q	I	T	R	I	M	D	E	R	N	R	Q	V	T	F	T	K	R	K	F	G	L	M	K	K	A	Y	E	L	S	V	L	C	D	C	E	I	A	L	I	I	F	N	S	S	N	K	L	F	Q	Y	A	S	T	M	V	L	K	Y	-	T	E	Y	-	-	-	-	-	-	-	-	-	-	-	-	-	-
Q	K	E	R	R	K	I	E	I	-	F	I	E	N	K	T	R	R	H	V	T	F	S	K	R	K	H	G	I	M	K	K	A	F	E	L	S	V	L	T	G	T	Q	V	L	L	L	V	V	S	E	T	G	L	V	Y	T	F	S	T	P	K	F	E	P	I	V	T	Q	E	G	R	N	L	I	Q	A	C	L	N	A	P	D	D

Member	Chain	UniProtKB	GO term
d1egwa_	A	Q02078	GO:0000977
d1egwa_	A	Q02078	GO:0003677
d1egwa_	A	Q02078	GO:0045944
d1egwa_	A	Q02078	GO:0046983
d1mnma_	A	P11746	GO:0000981
d1mnma_	A	P11746	GO:0000987
d1mnma_	A	P11746	GO:0003677
d1mnma_	A	P11746	GO:0045944
d1mnma_	A	P11746	GO:0046983
d1mnma_	A	P0CY08	GO:0000981
d1mnma_	A	P0CY08	GO:0000987
d1mnma_	A	P0CY08	GO:0003677
d1mnma_	A	P0CY08	GO:0045944
d1mnma_	A	P0CY08	GO:0046983

									10										20										30										40										50										60										70										80
G	-	-	-	R	K	I	Q	I	T	R	I	M	D	E	R	N	R	Q	V	T	F	T	K	R	K	F	G	L	M	K	K	A	Y	E	L	S	V	L	C	D	C	E	I	A	L	I	I	F	N	S	S	N	K	L	F	Q	Y	A	S	T	M	V	L	K	Y	-	T	E	Y	-	-	-	-	-	-	-	-	-	-	-	-	-	-
Q	K	E	R	R	K	I	E	I	-	F	I	E	N	K	T	R	R	H	V	T	F	S	K	R	K	H	G	I	M	K	K	A	F	E	L	S	V	L	T	G	T	Q	V	L	L	L	V	V	S	E	T	G	L	V	Y	T	F	S	T	P	K	F	E	P	I	V	T	Q	E	G	R	N	L	I	Q	A	C	L	N	A	P	D	D

									10										20										30										40										50										60										70										80
G	-	-	-	R	K	I	Q	I	T	R	I	M	D	E	R	N	R	Q	V	T	F	T	K	R	K	F	G	L	M	K	K	A	Y	E	L	S	V	L	C	D	C	E	I	A	L	I	I	F	N	S	S	N	K	L	F	Q	Y	A	S	T	M	V	L	K	Y	-	T	E	Y	-	-	-	-	-	-	-	-	-	-	-	-	-	-
Q	K	E	R	R	K	I	E	I	-	F	I	E	N	K	T	R	R	H	V	T	F	S	K	R	K	H	G	I	M	K	K	A	F	E	L	S	V	L	T	G	T	Q	V	L	L	L	V	V	S	E	T	G	L	V	Y	T	F	S	T	P	K	F	E	P	I	V	T	Q	E	G	R	N	L	I	Q	A	C	L	N	A	P	D	D

									10										20										30										40										50										60										70										80
G	-	-	-	R	K	I	Q	I	T	R	I	M	D	E	R	N	R	Q	V	T	F	T	K	R	K	F	G	L	M	K	K	A	Y	E	L	S	V	L	C	D	C	E	I	A	L	I	I	F	N	S	S	N	K	L	F	Q	Y	A	S	T	M	V	L	K	Y	-	T	E	Y	-	-	-	-	-	-	-	-	-	-	-	-	-	-
Q	K	E	R	R	K	I	E	I	-	F	I	E	N	K	T	R	R	H	V	T	F	S	K	R	K	H	G	I	M	K	K	A	F	E	L	S	V	L	T	G	T	Q	V	L	L	L	V	V	S	E	T	G	L	V	Y	T	F	S	T	P	K	F	E	P	I	V	T	Q	E	G	R	N	L	I	Q	A	C	L	N	A	P	D	D