PASS2.8 - Home

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x

beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x

hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x

                             10        20        30        40        50  
d1cvja1  (  11 )                                        a-------sLyVG-
d1fxla1  (  37 )                              skT---------------nLiVn-
d1fxla2  ( 119 )                              sasi-rd---A-------nLyVs-
d1jmta-  (  43 )                                       sq-------tIALl-
d1l3ka1  (   8 )                          kepeqlR---------------kLfIg-
d1l3ka2  ( 103 )                              tvk---------------kIfVG-
d1oo0b-  (  64 )                            pgpqrsveG---w-------iLfVt-
d1owxa1  ( 225 )                                                      
d1ufwa1  (   8 )                                       ssfqgpldAtvvvnl
d1uw4a-  (  50 )                                           ls---kVVIr-
d1wela1  ( 406 )                  ssgssgkspsgqkrsrsrsphe-----agfCvylk-
d1weya1  (   8 )                                                 liAc-
d1weza1  (   8 )                                       ssfqsttghCvhMr-
d1wf2a1  (   8 )                                ktdprsmnS-------rvfig-
d1whwa1  (  37 )                                    s---G-------rlfvr-
d1whxa1  ( 219 )                                     rskt-------vilAk-
d1whya1  (  81 )                      kigygkan-ptt--------------rlwvg-
d1wi8a1  (  88 )                             srlpkspp---Y-------tAflg-
d1wwha1  ( 169 )                                        hlddt---wVtVf-
d1x4da1  (   8 )                    qkg------------rvetrr-------vvhim-
d1x4fa1  (   8 )                    kkpegkpdqkfdqkq--elGr-------vihls-
d1x4ha1  (   8 )                        lpsdvtegK---------------tvfir-
d1x5oa1  (   8 )                         lkasgvqaqmakqqeq----dptnlyis-
d1zh5a2  ( 104 )                                        ykndvknrsVYIk-
d2b0ga1  (   1 )                      aqt----------eqppnq-------ilflt-
d2bz2a1  (  35 )                                   aprkgn-------tlyvy-
d2cpda1  ( 223 )                  dedtm--------------ssvk-------ilyvr-
d2cpfa1  ( 362 )                                                 lfik-
d2cpia1  ( 101 )                                                      
d2cpxa1  ( 291 )                   eeirkipmfssynpgepn---k-------vlylk-
d2cpya1  ( 536 )                                       egdvnsakvCAHit-
d2cq1a1  (  51 )                                dkmdgapsr-------vlhir-
d2cq2a1  (  25 )                      akhtllrhegietvsyatq-------slvvA-
d2cqha1  (   2 )                                              mnklyiG-
d2d9pa1  ( 286 )                             dritryqv---v-------nlyvk-
d2dgpa1  (  48 )                               m---kdhdai-------klfig-
d2dgsa1  ( 110 )                              sksn--------------kifvG-
d2dgta1  (  75 )                                     kast-------klhvg-
d2dgva1  ( 651 )                                    a---c-------qifvr-
d2dgxa1  ( 553 )                                      ngA-------dvqvs-
d2dhsa2  ( 104 )                                    avedr-------klfig-
d2disa1  (   8 )                                       nc-------rlfig-
d2dita1  (   8 )                                gpsrmrher-------vviik-
d2diva1  (   8 )                                   ma---a-------SlwMG-
d2dnna1  ( 225 )                                     kplpinpddl-yvsvh-
d2dnqa1  (   1 )                                       mv-------klfig-
d2do4a1  ( 791 )                           vfrystslek---h-------klfis-
d2e5ha1  (   1 )                               msgglapsks-------tvyvs-
d2ek1a1  ( 875 )                                              ptvikvq-
d2fc8a1  (   8 )                            pnar-sqps---k-------tlfvk-
d2fc9a1  (   8 )                             nstwsges---k-------tlvls-
d2ghpa1  ( 116 )                                              ectLw-t-
d2ghpa2  (  41 )                                        t-------tVlVk-
d2ghpa3  ( 206 )                                                      
d2km8c2  ( 242 )                                    t---g-------kifvg-
d2krra1  (   1 )                                        gtepttafnlfvg-
d2krra2  (  86 )                             dskkerdA---r-------tllAk-
d2la4a1  ( 315 )              sqtiglppqvnpqavdhiirsapprvt-------tAyig-
d2la6a1  (  11 )                                  sdn---n-------tifvq-
d2lmia1  (   2 )                                     skleeevddvflirAq-
d2lxia-  (   1 )                                              snivmlr-
d2mqma-  ( 174 )                            qkisrpgdsddsrsvns---vllFt-
d2mzqa1  ( 329 )                 hidetaakftegvnpgGdrn---c-------fiyCs-
d2mzra1  ( 144 )                       areldstyeekvnrnySn-------sifvg-
d2mzsa1  ( 262 )                                                evivk-
d2n3la1  (   1 )                                                      
d2pe8a1  ( 301 )                                                      
d2roka1  ( 430 )                                      gpdlqpkrdhvlHvt-
d2rs8a1  (  68 )                             gektftqr---s-------rlfvG-
d2rvja1  ( 438 )                                        mpptnvrDCirlr-
d2x1fa1  (  16 )                                   ps---r-------VVyLG-
d2xsfa-  (  35 )                                                      
d2ytca1  ( 234 )                            edktit--------------tlyvG-
d2ywka1  (   5 )                            qeeadr--------------tVfVg-
d3b4da-  ( 169 )                              adar--------------SIyVg-
d3egna-  ( 387 )    ecIsrreLekgrisreemetlsvFrsyepgepn---c-------rIyVk-
d3feyb-  (  12 )                 ds------yveeqekllkks---c-------tLyVg-
d3jb9y2  ( 172 )                               qny--------------tLyVg-
d3lqva-  (  13 )                               lppeVn---r-------iLyIr-
d3md1a1  ( 161 )                                    t---f-------nLfVg-
d3mdfa-  (   1 )                            matt----k---r-------vLyVG-
d3n9uc-  (  82 )                                        a-------aVyVG-
d3r27a-  (  97 )                                   ktpaSp-------VVhIr-
d3rw7a1  ( 118 )                                                      
d3u1la2  ( 131 )                            r-kknk--------------tLyVG-
d3ulha-  ( 100 )                               agvetg---g-------kLlVs-
d3zzza-  ( 181 )                                            s---pVLIi-
d4a8xa1  ( 159 )                              kpt---------------kvhig-
d4ch0s1  (  28 )                         gsrdtmft---------------kifvg-
d4ckoa2  ( 338 )                                        t-------VLlVs-
d4ckoa3  ( 446 )                                    nfnifppsa---tLhLs-
d4f25a1  (  99 )                                        G-------nIfIk-
d4iufa-  ( 103 )                               ts---------------dlivl-
d4ljma-  ( 401 )                                 Gpeg---A-------nLfIy-
d4uqta-  (  25 )                          neykdnA---------------yiyiG-
d4yuda1  ( 144 )                      n--ltpeerdar--------------TVfCm-
d4zkaa-  (   3 )                               enksqp---k-------rlhvs-
d5d78a1  ( 313 )                                        k-------tilvk-
d5kwqa1  ( 101 )                      aaqrqgAlaimS--------------rVyVG-
d5kwqa2  ( 201 )                             laeeAraf---n-------rIyVa-
d5lsla-  (   8 )                                    g---n-------tVyVg-
d5o2va-  (   1 )                                  medempk-------tlyvg-
d5t9pa-  (  88 )                                  eys---G-------IIyVs-
d5tbxb1  (   2 )                               ma-sDe---G-------KlfvG-
d5uzga-  (  48 )                                              pkfVrLr-
d5uzma-  ( 143 )                                            gtafVVkLr-
d5uzna-  ( 478 )                                            ieyytIhMr-
d5w0ga1  ( 148 )                                    a---r-------rlyvG-
d5w0ha1  ( 258 )                               ah---------------klfig-
d6ez7a1  ( 303 )                                        n-------sIfIk-
d6f4jc-  (   4 )                                  lpn---q-------TIyIn-
d6q2ia-  (   1 )                 magltvrdpavdrslr---------------SvFvG-
d6ud7c-  ( 248 )                                   gp---m-------rLyVG-
d6ybso-  ( 238 )                               na---------------tIrVt-
                                                                bbbbb 

                             60        70        80        90        100 
d1cvja1  (  17 )    -dLh-pdVt---------------------------------eamLy--e
d1fxla1  (  45 )    -yLP-qnmt---------------------------------qeeFr--s
d1fxla2  ( 131 )    -gLp-ktmt---------------------------------qkeLe--q
d1jmta-  (  50 )    -niyrnpqdglrsavsdvem--------q-------ehydeffeeVf--t
d1l3ka1  (  20 )    -gLs-feTt---------------------------------desLr--s
d1l3ka2  ( 111 )    -gIk-edTe---------------------------------ehhLr--d
d1oo0b-  (  79 )    -sIh-eeAq---------------------------------edeIq--e
d1owxa1  ( 225 )                         sleekigcllkFsgdlddqtcredlh--i
d1ufwa1  (  23 )    qspt-l-----------eEk--------n-------eFPedlrtelm--q
d1uw4a-  (  57 )    -rLP-pt---------------------------------ltkeqLq--e
d1wela1  ( 436 )    -glp-f------------------------------eAe---nkhvi--d
d1weya1  (  12 )    -van-ddvFse----------------------------setrakFe--s
d1weza1  (  22 )    -glP-y------------------------------rAt---endiy--n
d1wf2a1  (  22 )    -nlntl---------------------------------vvkksdve--a
d1whwa1  (  44 )    -nls-ytSs---------------------------------eedle--k
d1whxa1  ( 228 )    -nlp-a---------------------------------gtlaaeiq--e
d1whya1  (  97 )    -glg-p---------nts------------------------laala--r
d1wi8a1  ( 102 )    -nlp-ydvt---------------------------------eesik--e
d1wwha1  ( 179 )    -gFp-qa----------------------------------sasyIl--l
d1x4da1  (  22 )    -dFqrg---------------------------------knlryqll--q
d1x4fa1  (  32 )    -nlPhs---------------------------------gysdsavl--k
d1x4ha1  (  22 )    -nls-fdSe---------------------------------eealG--e
d1x5oa1  (  32 )    -nlp-l------------------------------sMd---eqEle--n
d1zh5a2  ( 117 )    -gFp-t------------------------------dAt---lddIk--e
d2b0ga1  (  15 )    -nlP-e---------------------------------etnemmls--m
d2bz2a1  (  46 )    -Ge------------------------------------dMtptllr--g
d2cpda1  ( 237 )    -nlm-l---------------------------------stseemie--k
d2cpfa1  ( 366 )    -nln-f---------stt------------------------eetlk--g
d2cpia1  ( 101 )                        asvrvvqknlvfvvglsqrladpevlkrpe
d2cpxa1  ( 315 )    -nls-prvt---------------------------------erdlv--s
d2cpya1  ( 550 )    -nip-f------------------------------sit---kmdvl--q
d2cq1a1  (  65 )    -klpg----------------------------------evtetevi--a
d2cq2a1  (  49 )    -nGG-lgn-------------------------------gvsrnqll--p
d2cqha1  (   9 )    -nls-p------------------------------avt---addlr--q
d2d9pa1  ( 300 )    -nld-dgid---------------------------------derlr--k
d2dgpa1  (  60 )    -qipr----------------------------------nldekdlk--p
d2dgsa1  ( 119 )    -giP-h---------nCg------------------------etelr--e
d2dgta1  (  84 )    -niS-p---------------------------------tCtnqelr--a
d2dgva1  ( 658 )    -nlp-fdFt---------------------------------wkmlk--d
d2dgxa1  ( 561 )    -niDyrls------------------------------rkelqqllq--e
d2dhsa2  ( 114 )    -misk----------------------------------kctendir--v
d2disa1  (  15 )    -giPk----------------------------------mkkreeil--e
d2dita1  (  22 )    -nMFhpm--------dfedd--------p-------lvlneiredlr--v
d2diva1  (  16 )    -dle-pyMd---------------------------------enfis--r
d2dnna1  ( 240 )    -gMp-f------------------------------sAm---endvr--d
d2dnqa1  (   8 )    -nlpr----------------------------------eAteqeir--s
d2do4a1  ( 807 )    -glp-fsct---------------------------------keele--e
d2e5ha1  (  16 )    -nlPf----------------------------------sltnndly--r
d2ek1a1  ( 882 )    -n-p-f------------------------------tvs---ideIl--d
d2fc8a1  (  22 )    -gls-edtt---------------------------------eetlk--e
d2fc9a1  (  22 )    -nls-ysAt---------------------------------eetlq--e
d2ghpa1  ( 123 )    -nFP-p------------------------------syt---qrnIr--d
d2ghpa2  (  47 )    -nLp-ksyn---------------------------------qnkVy--k
d2ghpa3  ( 206 )                             tlegreIIrnLsteLLdenlLr--e
d2km8c2  ( 249 )    -gig-pdvr---------------------------------pkeFe--e
d2krra1  (  14 )    -nln-f-----------nks--------a-------pel---ktgis--d
d2krra2  ( 100 )    -nlp-ykvt---------------------------------qdelk--e
d2la4a1  ( 347 )    -niph----------------------------------fAteadli--p
d2la6a1  (  20 )    -glg-envt---------------------------------iesva--d
d2lmia1  (  18 )    -glp-w------------------------------sct---medvl--n
d2lxia-  (   8 )    -mlp-q------------------------------aAt---eddir--g
d2mqma-  ( 196 )    -iln-pi-------------------------------ysittdvly--t
d2mzqa1  ( 355 )    -nlp-fsta---------------------------------rsDlf--d
d2mzra1  ( 167 )    -nlt-y---------------------------------dStpedlt--e
d2mzsa1  ( 267 )    -nlp-a------------------------------svn---wqalk--d
d2n3la1  (   1 )                   mviresvsriyvGn-------lpshvssrdve--n
d2pe8a1  ( 301 )                            kcptkVVLLrnmgag---leetk---
d2roka1  ( 445 )    --Fp-k------------------------------ewk---tsdly--q
d2rs8a1  (  82 )    -nlP-pdit---------------------------------eeeMr--k
d2rvja1  ( 451 )    -glp-y------------------------------aat---iedil--d
d2x1fa1  (  24 )    -sIp-ydqt---------------------------------eeqIl--d
d2xsfa-  (  35 )                            gimpntVfVggIdv--mdeteIr--s
d2ytca1  ( 245 )    -glg-d---------tit------------------------etdlr--n
d2ywka1  (  16 )    -nLe-a---------rVr------------------------eeiLy--e
d3b4da-  ( 178 )    -nVd-y---------gAt------------------------aeeLe--a
d3egna-  ( 426 )    -NLa-khVq---------------------------------ekdLk--y
d3feyb-  (  46 )    -nLs-fyTt---------------------------------eeqIy--e
d3jb9y2  ( 180 )    -git-pt--------ddi------------------------eeivs--r
d3lqva-  (  25 )    -nLp-ykIt---------------------------------aeeMy--d
d3md1a1  ( 168 )    -dLn-vnVd---------------------------------detLr--n
d3mdfa-  (  12 )    -gLA-eeVd---------------------------------dkvLh--a
d3n9uc-  (  88 )    -sFs-wwTtdqqL-----------------------------i-------
d3r27a-  ( 108 )    -gLid----------------------------------gVveadLv--e
d3rw7a1  ( 118 )                        nwfkItIpy-------Grk-YdkawLl--s
d3u1la2  ( 141 )    -gId-gALnskhLkpaqi------------------------esrIr--f
d3ulha-  ( 112 )    -nLd-fgVs---------------------------------dadIq--e
d3zzza-  ( 188 )    -Ven-lf-------------------------------ypVtLdvLh--q
d4a8xa1  ( 167 )    -rlt-rnvt----------------------------------dhim--e
d4ch0s1  (  41 )    -glp-yhts---------------------------------dktlh--e
d4ckoa2  ( 344 )    -nLn-ee---mVt-----------------------------pqsLF--t
d4ckoa3  ( 461 )    -nIp-p---------------------------------svaeedLr--t
d4f25a1  ( 105 )    -nLd-ksid---------------------------------nkaLy--d
d4iufa-  ( 110 )    -glp-wktt---------------------------------eqdlk--e
d4ljma-  ( 411 )    -hLp-qefg---------------------------------dqdIl--q
d4uqta-  (  37 )    -nln-relt---------------------------------egdil--t
d4yuda1  ( 159 )    -qLA-a---------rIr------------------------prdLe--e
d4zkaa-  (  15 )    -niP-frFr---------------------------------dpdlr--q
d5d78a1  ( 319 )    -nlp-sdtt---------------------------------qeevl--d
d5kwqa1  ( 118 )    -sIy-y---------elg------------------------edtIr--q
d5kwqa2  ( 215 )    -sVh-qdls---------------------------------dddIs---
d5lsla-  (  15 )    -nId-prIt---------------------------------keqLy--e
d5o2va-  (  13 )    -nlsr----------------------------------dvtealil--q
d5t9pa-  (  97 )    -rLP-hgFh---------------------------------ekeLs--k
d5tbxb1  (  13 )    -gls-fdtn---------------------------------eqsle--q
d5uzga-  (  55 )    -gLp-w------------------------------sAt---hkeIl--d
d5uzma-  ( 152 )    -gLp-y------------------------------avt---eqqIe--e
d5uzna-  ( 487 )    -gLp-y------------------------------tSf---endVf--k
d5w0ga1  ( 155 )    -nip-fgiteeaM-----------------------------mdfFn--a
d5w0ha1  ( 265 )    -glp-nyln---------------------------------ddqvk--e
d6ez7a1  ( 309 )    -nLp-tiTt---------------------------------rddIl--n
d6f4jc-  (  13 )    -nLn-ekikkeeL-----------------------------kksLy--a
d6q2ia-  (  22 )    -nip-yeAt---------------------------------eeqlk--d
d6ud7c-  ( 256 )    -sLh-fnIt---------------------------------edmLr--g
d6ybso-  ( 245 )    -nLs-edTr---------------------------------etdLq--e
                                                              aaaaa  a

                             110       120       130       140       150 
d1cvja1  (  30 )    kFspA-g--------pilsIrVcrdm---it-rrslgyAyVnFqq-padA
d1fxla1  (  58 )    lFgsi-g--------eIesCkLvrdk---it-gqslgyGfVnYid-pkdA
d1fxla2  ( 144 )    lFsqy-g--------rIitSrilvdq---vt-gvsrGvGfIrFdk-rieA
d1jmta-  (  88 )    eMeekyg--------eVeeMnVcdn---l--gdhlvGnVyVkFrr-eedA
d1l3ka1  (  33 )    hFeqw-g--------tLtdCvVmrdp---nt-krSrgfGfVTYat-veeV
d1l3ka2  ( 124 )    yFeqy-g--------kIevIeimtdr---gs-gkkrgfAfVtFdd-hdSV
d1oo0b-  (  92 )    kFcdy-g--------eIknIhLnldr---rt-gfSkgyAlVeYet-hkqA
d1owxa1  ( 252 )    lFsn-----------hGeikwidfvrga-------keGiilFkekAkeAl
d1ufwa1  (  44 )    tlGsyg--------t--ivlvrin-----------qgqMlvtFad-shsA
d1uw4a-  (  70 )    hLqpm-p--------ehdyFeffs--ndtslyphmyArAyInFkn-qedi
d1wela1  ( 449 )    FFkkld--ive------dsiyiAygpn-----gkAtgeGFveFrn-eady
d1weya1  (  30 )    lFrtydk---------dttFqyfks----------fkrvrinFsn-plsa
d1weza1  (  35 )    fFsp-l-nPm--------rvhieigp-----dgrvtgeAdvEFat-hedA
d1wf2a1  (  36 )    iFsk-yg--------kivgCsvhk------------gfAfvqYvn-ernA
d1whwa1  (  57 )    lFsay-g--------plselhYpids---lt-kkPkgfAfvtFmf-pehA
d1whxa1  ( 241 )    tFsrfgs---------lGrvllp--e------g--gitAiveFle-pleA
d1whya1  ( 110 )    eFdrfg---------sirtidhvk----------gdsfAyiqYes-ldaA
d1wi8a1  ( 115 )    fFr----------glnisavrlprep---snperlkgfGyAeFed-ldSl
d1wwha1  ( 191 )    qFaqy-g--------nilkhvmsn----------tgnwMhIrYqs-klqA
d1x4da1  (  36 )    lvep-fg--------visnhliln----------kineAFieMat-tedA
d1x4fa1  (  46 )    lAep-yg--------kiknyilmr----------mksqAfieMet-redA
d1x4ha1  (  35 )    vlqqf-g--------dlkyvrvvlhp---dt-ehSkgcAfAqFmt-qeAA
d1x5oa1  (  45 )    Mlkpfg-qvi--------strilrds-----sgtSrgvGfArMes-tekC
d1zh5a2  ( 130 )    wLedkg-qvl--------niq-rrtl-----hkafkgSIfVvFds-iesA
d2b0ga1  (  28 )    lFnqfp---------Gfkevrlvp---------nrhdiAfveFtt-elqS
d2bz2a1  (  57 )    aFsp-fg--------niidlsmdpp---r-------nCAfvtYek-mesA
d2cpda1  ( 250 )    eFnnikp-------gavervkki--r----------dyAfvhFsn-redA
d2cpfa1  ( 379 )    vFskvg---------aiksCtiskkknkag-vllSmgfGfveYkk-peqa
d2cpia1  ( 131 )    yFgkfg---------kihkvvinnstsya-gsqgpsasAyvtYir-sedA
d2cpxa1  ( 328 )    lFarfqek-----kgppiqFrmm-t------g-rmrgqAfitFpn-keiA
d2cpya1  ( 563 )    flegip--vde------nAvhvlvdnn-----gqglgqAlvqFkn-eddA
d2cq1a1  (  78 )    lGlp-fg--------kvtnilmlk----------gknqAflelat-eeaA
d2cq2a1  (  64 )    vlekCg---------lvdallMpp---------n-kpySfArYrt-teeS
d2cqha1  (  22 )    lFgdrklpla-------gqvllk------------sgyAfvdypd-qnwA
d2d9pa1  ( 313 )    aFspf-g--------titsAkvmmeg------grSkgfGfvCFss-peeA
d2dgpa1  (  73 )    lFeefg---------kiyeltvlkdrftg----mhkgcAfltYce-resA
d2dgsa1  ( 132 )    yFkkfg---------vvtevvMiyd---ae-kqrprgfGfitFed-eqSv
d2dgta1  (  97 )    kFeeygp---------vieCdiv--k----------dyAfvhMer-aedA
d2dgva1  ( 671 )    kFneC-g--------hvlyAdikmen------gkskgcGvvkFes-pevA
d2dgxa1  ( 578 )    AFar-hg--------kvksvelsph---t--dy--qlkAvvqMen-lqdA
d2dhsa2  ( 127 )    mFssfg---------qieecrilrgpdg-----lSrGcAfvtFtt-ramA
d2disa1  (  28 )    eiakvte--------gvldvivyA-saad--kmknrgfAfveYes-hrAA
d2dita1  (  46 )    ECsk-fg--------qirklllfdr--------hpdGvASvsFrd-peeA
d2diva1  (  29 )    AFatmgE--------tvmsvkiirnr---lt-giPagyCfveFad-latA
d2dnna1  ( 253 )    fFhglr--vda--------vhllkdh-----vgrnngnGlvkFls-pqdt
d2dnqa1  (  21 )    lFeq-yg--------kvleCdiik------------nyGfvhied-ktaA
d2do4a1  ( 820 )    iCkah-g--------tvkdlrlvtnr----a-gkpkglAyveYen-esqA
d2e5ha1  (  29 )    iFskyg---------kvvkvtimkdkdtr----kskGvAFilFld-kdsA
d2ek1a1  ( 895 )    fFygyq--vip------gsVclkynek------gptge-AVaFes-rdea
d2fc8a1  (  35 )    sFd------------gSvrArivtdr---et-gsskgfGfvdFns-eedA
d2fc9a1  (  35 )    vFe------------kAtfikvpqnq----n-gkSkgyAfieFas-fedA
d2ghpa1  ( 136 )    lLqdinVvAl--------sIrlp------------rrfAyidVts-kedA
d2ghpa2  (  60 )    yFkhCgpI-i--------hvdvadSl---kk---nfrfArIeFar-ydGA
d2ghpa3  ( 230 )    sfegfg---------sIekinip-----a-gqkfnnCcAfvF-en-kdSA
d2km8c2  ( 262 )    fFsqw-G--------tiidAqlmld----kdtgqsrgfGfvtYds-adav
d2krra1  (  31 )    vFakndlavv--------dvrigm----------trkfGyvDFes-aedl
d2krra2  ( 113 )    vFe------------dAaeirlvsk------dgkSkgiAyieFkt-eadA
d2la4a1  ( 360 )    lFqn-fg--------fildFkHype----------kgcCfikYdt-heqA
d2la6a1  (  33 )    yFkqigii-ktnkktgqpminlytdr---etg-klkGeAtvsFdd-ppsA
d2lmia1  (  31 )    FFsdCr--irn--ge--nGihfllnr-----dgkrrgdAlieMes-eqdv
d2lxia-  (  21 )    qlqshgvqAr--------evrlMrnks----sgqsrgfAfveFsh-lqdA
d2mqma-  ( 211 )    iCnpc-g--------pvqRivifr--k-------ngvqAmvEFds-vqsA
d2mzqa1  ( 368 )    lFgpi-g--------kinnAelkpqe---n--gqptgvAvveYen-lvdA
d2mzra1  ( 180 )    fFsqig---------kvvradiitsr------ghhrgmGtveFtn-sddv
d2mzsa1  ( 280 )    iFkecg-------nv--ahAdveld-g----dgvStGsgtvsFyd-ikdl
d2n3la1  (  27 )    eFrkYg---------nilkcdvkktvs---------gaafAfieF-e-da
d2pe8a1  ( 330 )    cekY-----------gVgkCvifeipgapdde---AvrIFLeFev--esA
d2roka1  ( 457 )    lFsafg--------n--iqiswid-----------dtsAfvslsq-peqv
d2rs8a1  (  95 )    lFekYg---------kAgevfihk----------dkgfGfirlet-rtlA
d2rvja1  ( 464 )    flgefatdirt------hgvhmvlnhq-----grpsgdAFiqMks-adrA
d2x1fa1  (  37 )    lCsnv-g--------pVinlkMmfdp---qt-grSkgyAfIEF-d-lesS
d2xsfa-  (  59 )    fFaryg---------sVkeVkiitdr-----tgvskgyGfVsFyn-dvdv
d2ytca1  ( 258 )    hFyqFg---------eirtitvv----qrq------qcAfiqFat-rqAA
d2ywka1  (  29 )    lFlqAg---------pLtkVtickd-r----egkpksfGfVCFkh-peSv
d3b4da-  ( 191 )    hFhgcg---------sVnrVtilcdkf----sghpkGfAyIeFsd-keSv
d3egna-  ( 439 )    IFGrYVdf-ssetqrimfdIrlmke------g-rmkgqAfIgLPn-ekaA
d3feyb-  (  59 )    lFsks-g--------dIkkIimGld--------tacgfCFVeYys-radA
d3jb9y2  ( 194 )    hFaewg---------dierirvl----nsr------giafItYln-eanA
d3lqva-  (  38 )    iFgkygpI-r--------qIrvgntp-------etrgtAyVvYed-ifdA
d3md1a1  ( 181 )    aFkdf-p--------sylsGhVmwdm---qt-gssrgyGfVsFts-qddA
d3mdfa-  (  25 )    aFipf-g--------dItdiqipldy---et-ekhrgfAfVeFel-aedA
d3n9uc-  ( 101 )    vIrsIgVy-------dvvelkfaen-----angqskgYAeVvVas-ensv
d3r27a-  ( 121 )    aLqe-fg--------pIsyVvvmp----------kkrqAlVeFed-vlgA
d3rw7a1  ( 138 )    mIqskCs-------vpftpieFhye-n---------trAQFfVed-astA
d3u1la2  ( 163 )    vFsrlg---------didrIrYv----esk------nCGfVkFky-qanA
d3ulha-  ( 125 )    lFaef-g--------tlkkAaVhydr---s--grSlgtAdVhFer-kadA
d3zzza-  ( 203 )    iFskf-g--------tVlkIitft--n-------nqfqAlLqYad-pvsA
d4a8xa1  ( 180 )    iFsty-g--------kikmidmpver---mhphlskgyAyveFen-pdeA
d4ch0s1  (  54 )    yFeqf-g--------dieeAvvitdr---nt-qkSrgyGfvtMkd-raSA
d4ckoa2  ( 358 )    lFgvyGdV-q--------rVkil-------------dsALIqMad-gnqS
d4ckoa3  ( 474 )    lFantgG--------tVkaFffh--------------mAlLqMat-veeA
d4f25a1  ( 118 )    tFsaf-g--------nIlsckVvcde------ngskgyGfVhFet-qeAA
d4iufa-  ( 123 )    yFstf-g--------evlmvqvkkdl---kt-ghSkgfGfvrFte-yetq
d4ljma-  ( 424 )    mFmpf-g--------nVisAkVfid-----t-nlSkcfGfVSYdn-pvsA
d4uqta-  (  50 )    vFsey-g--------vPvdvilsrde---nt-geSqgfAYlkYed-qrSt
d4yuda1  ( 172 )    fFstvg---------kVrdVrmisdn-------rskgiAyVEFvd-vsSv
d4zkaa-  (  28 )    mFgqf-g--------kildveiifn----er--gSkgfGfvtFen-SadA
d5d78a1  ( 332 )    yFstigpi-k--------svfisekq---an---tphkAfvtYkn-eeeS
d5kwqa1  ( 131 )    aFapfg---------pIksidMs----------wHkgfAfVeYev-peAA
d5kwqa2  ( 228 )    vFeaf-----------gisatLardp---tt-g-HkgyGfIeYek-aqss
d5lsla-  (  28 )    lFiqi-n--------pVlrIkYpkdk---vl-qayqgyAfIeFyn-qgdA
d5o2va-  (  26 )    lFsq-iG--------pCknCkmimd---t--ag-ndPyCfveFhe-hrhA
d5t9pa-  ( 110 )    yFaqf-g--------dlkevrLArnk---kt-gnSrhyGFLeFvn-kedA
d5tbxb1  (  26 )    vFsky-g--------qisevvvvkdr---et-qrsrgfGFvtFen-iddA
d5uzga-  (  68 )    fLenVn--Vtngsag----Ihlvtsrv----dgkntgeAyVeVas-qeDv
d5uzma-  ( 165 )    fFsgLd--iktdreG----Ilfvmdr-----rgratgeAFVqFes-qddT
d5uzna-  ( 500 )    FFep-i-rPa--------nVrInynk-----kglHsgtAdAyFdt-yedS
d5w0ga1  ( 172 )    qMrlgglt-qapg-nPvlavqinq-----------knfAfleFrs-vdEt
d5w0ha1  ( 278 )    lltsf-g--------plkafnlvkds---at-glSkGyAfCeYvd-invt
d6ez7a1  ( 322 )    fFseVg---------pIksIylsn-----------alwAfVtYkn-ssdS
d6f4jc-  (  30 )    iFsqfgqI-l--------dIvAlktl-------kMrgqAFViFke-igsA
d6q2ia-  (  35 )    iFsev-g--------pvvsfrlvydr---et-gkpkgyGfCEYqd-qetA
d6ud7c-  ( 269 )    iFepf-g--------rIesIqLmmds----t-grSkgyGfItFsd-secA
d6ybso-  ( 258 )    lFrpf-g--------sisriyLakdk---tt-gqSkgfAfIsFhr-redA
                    aa                bbbb               bbbbbb   aaaa

                             160       170       180       190       200 
d1cvja1  (  66 )    erAldtmnf--------------dvik---gkpVrImwsq----------
d1fxla1  (  94 )    ekAintln--------------glrlq---tktIkVsy------------
d1fxla2  ( 180 )    eeAikglng--------------qkps-gAtepItVkfa           
d1jmta-  ( 124 )    ekAvidLn--------------nrwfng---qpihAelsp          
d1l3ka1  (  69 )    daAmn-ar--------------pHkVd---grvVePkr------------
d1l3ka2  ( 160 )    dkIviqk---------------yHtVn---ghnCeVrk------------
d1oo0b-  ( 128 )    laAkeaLng--------------aeIm---gqtIqVdwcf----------
d1owxa1  ( 284 )    gkAKdann--------------gnlqlrn--kevtWevle----------
d1ufwa1  (  72 )    lsvld-v--dg--mkvk-------------gravki              
d1uw4a-  ( 108 )    ilFrdrFdgyv-Fldnkg-----------qeypAiVefAp-fqka     
d1wela1  ( 485 )    kaAlc-r--hk--qyMg-------------nrfiqvhpit----------
d1weya1  (  60 )    adArlrlhkte-Flg----------------keMklyfaq----------
d1weza1  (  69 )    vaAma-----kdkanMq-------------hryvelflnS----------
d1wf2a1  (  64 )    raAvagEd--------------grmiag---qvldinlaa----------
d1whwa1  (  93 )    vkAyaevdg--------------qvfq---grmlhvlpst----------
d1whxa1  ( 271 )    rkAfrhlays--------------kFhh---vplylewAp-igvfgaapq
d1whya1  ( 140 )    qaAcakMrgfp-lggpd--------------rrlrvdfak          
d1wi8a1  ( 151 )    lsAls-lne--------------eslg---nkrirvdvad----------
d1wwha1  ( 221 )    rkAls-kdgri-fge---------------simIgVkpCi-dknvme   
d1x4da1  (  66 )    qaAvdyyttt------------pAlvfg---kpvrvhlsq----------
d1x4fa1  (  76 )    maMvdhclkk------------alwFqg---rcvkvdlse----------
d1x4ha1  (  71 )    qkClaaAsl--------eaeggGlkld---grqlkvdl------------
d1x5oa1  (  80 )    eavighF--ngkfiktppgvs-------aptepllCkf            
d1zh5a2  ( 165 )    kkFve-----tpgqkYk-------------etdLlilf------------
d2b0ga1  (  59 )    naAKealqgf--------------kitpt--haMkitFak-k        
d2bz2a1  (  87 )    dqAvaeln--------------gtqves---vqlkvniar----------
d2cpda1  ( 280 )    veAmkalngk--------------vldg---Spievtlak-pv--dkds 
d2cpfa1  ( 418 )    qkAlkqlqght-vdg----------------hklevrise-rat------
d2cpia1  ( 170 )    lrAiqcvn--------------nvvvd---grtlkAs             
d2cpxa1  ( 364 )    wqAlhlvng--------------ykly---gkilvieFgk-nkkqrs   
d2cpya1  ( 599 )    rkSer-l--hr--kkln-------------greAfvhvvt----------
d2cq1a1  ( 108 )    itMvnyYsav------------tphlrn---qpiyiqySn----------
d2cq2a1  (  94 )    krAyvtlngk------------evvDdlgqkitlylnFve-kvqw     
d2cqha1  (  52 )    irAietl--sg-kvelh-------------gkiMevdysv----------
d2d9pa1  ( 347 )    tkAvteMng--------------riva---tkplyvalaq----------
d2dgpa1  ( 109 )    lkAqsalhe-------------qktlpg-mnrpiqvkpad----------
d2dgsa1  ( 168 )    dqAvn-mhfHd-img----------------kkvevkrae-prdsks   
d2dgta1  ( 125 )    veAirgldnt--------------eFqg---krMhvqlSt-sr--lrta 
d2dgva1  ( 705 )    erAcrmMng--------------mkls---greidvridr----------
d2dgxa1  ( 611 )    igAvnslh--------------rykigs---kkilvslat----------
d2dhsa2  ( 162 )    qtAikaMhq-------------aqtmeg-csspmvvkfad          
d2disa1  (  66 )    amArrklmpg------------riqlwg---hqiavdwae----------
d2dita1  (  78 )    dyCiqtld--------------grwfgg---rqitAqawd----------
d2diva1  (  66 )    ekclhking--------k-----plpgAtpakrFklnyat----------
d2dnna1  ( 287 )    feAlk-r--nr--mlMi-------------qryvevspAt----------
d2dnqa1  (  49 )    edAirnlh--------------hyklhg---vninveask----------
d2do4a1  ( 855 )    sqAvmkMdg--------------mtik---eniikvaisn          
d2e5ha1  (  65 )    qnCtrainn--------------kqlfg---rvikAsiai          
d2ek1a1  ( 931 )    taAvidl--nd--rpig-------------srkVkL              
d2fc8a1  (  68 )    kaAkeamed--------------geid---gnkvtldwak----------
d2fc9a1  (  67 )    kealnscnk--------------reie---grairlelqg----------
d2ghpa1  ( 172 )    ryCvekL--ng--lkie-------------gytLvTkvsn----------
d2ghpa2  (  94 )    laAit-kth--------------kvVg---qneIiVshlt          
d2ghpa3  ( 267 )    erAlq--n--------------rsllg---nreIsVsladkkp       
d2km8c2  ( 298 )    drvcq---------------nkfidFkd---rkieikrae----------
d2krra1  (  62 )    ekAlel----t-glkvf-------------gneiklekpk----------
d2krra2  ( 144 )    ektfeekqg--------------teid---grsislyytg-epk------
d2la4a1  ( 390 )    AvCivala--------------nfpfqg---rnlrtgWGk----------
d2la6a1  (  77 )    kaAidwFdg--------------keFs---gnpikvsfat          
d2lmia1  (  69 )    qkAle-k--hr--mymg-------------qryvevyein----------
d2lxia-  (  58 )    trWMean--qh-slnil-------------gqkvsMhysd----------
d2mqma-  ( 242 )    qrAkaslngad-iy---s-----------gcCtlkieyAk-ptrlnvfkn
d2mzqa1  ( 403 )    dfCiqklnn--------------ynyg---gcslqisYAr----------
d2mzra1  ( 214 )    drAirqydga--------------ffmd---rkifvrqdn          
d2mzsa1  ( 315 )    hrAieky----n------gys-------iegnvldvks------------
d2n3la1  (  57 )    rdAadAikekdgcdfe--------------gnklrvevpfnare      
d2pe8a1  ( 366 )    ikAvvdln--------------gryf-gg--rvVkAcfYn----------
d2roka1  ( 485 )    qiAvnts----k------yae-----------syriqt------------
d2rs8a1  ( 125 )    eiAkveldn--------------mplr---gkqlrvrfac-hsaslt   
d2rvja1  ( 502 )    fmAaqkC--hk--knMk-------------dryvevfqcs----------
d2x1fa1  (  73 )    asAvrnLng--------------yqlg---srfLkCgySs----------
d2xsfa-  (  94 )    qkivesqi--------------nfh-----gkklklgpAir         
d2ytca1  ( 288 )    evAAekSfnkl-ivn---------------grrlnvkwgr          
d2ywka1  (  64 )    syAialLngir-lyg----------------rpInV              
d3b4da-  ( 227 )    rtSla-ldesl-frg----------------rqIkVipkr          
d3egna-  ( 480 )    akAlkeAnG--------------yvlf---gkpMVVqfAr---sarp   
d3feyb-  (  95 )    enAMryIng--------------trld---driIrTdwda----------
d3jb9y2  ( 224 )    qfAk-aMahqs-le------------------cLnVrwat-tdpnpas--
d3lqva-  (  71 )    knAvdhLsg--------------fnvs---nryLvVlyyn-Anrafqkm-
d3md1a1  ( 217 )    qnAmdsmqg--------------qdln---grpLrInwaa----------
d3mdfa-  (  61 )    aaAidnmne--------------self---grtIrVnlAk          
d3n9uc-  ( 139 )    hkLlelLpg--------------kvLn---gekVdVrpat----------
d3r27a-  ( 151 )    cnAvnyaadn------------qIyIag---hpAfVnyst----------
d3rw7a1  ( 170 )    saLkaVnyk---IlDre-------------nrrIsIiinssappht    
d3u1la2  ( 193 )    efAkeamsnqt-LLlpsdkewd----drregtgLlVkwan          
d3ulha-  ( 160 )    lkA--qyng--------------vpld---grp-niqlvt----------
d3zzza-  ( 235 )    qhAklsldgqn-Iy---n-----------acCtLrIfs-k-ltsLnVynn
d4a8xa1  ( 217 )    ekAlkhmd--------------ggqid---gqeitAta------------
d4ch0s1  (  90 )    erAck-dp--------------nPiid---grkAnvnl------------
d4ckoa2  ( 389 )    qlAmnhLng--------------qkmy---gkiIrVtlSk-hqtvpgltk
d4ckoa3  ( 505 )    iqAlidLhnyn-lg-----------------nhhLVsfSk-sti      
d4f25a1  ( 152 )    erAiekMng--------------mlln---drkVfVgrfs          
d4iufa-  ( 159 )    vkvms--q--------------rHmid---grwCdCkl------------
d4ljma-  ( 460 )    qaAiqamng--------------fqig---mkrLkVqlk           
d4uqta-  (  86 )    ilAvdnln--------------gfkig---gralkidh------------
d4yuda1  ( 208 )    plAig-ltgqr-vlg----------------vpIiVqasq          
d4zkaa-  (  62 )    drAreklhg--------------tvve---grkievnnAt----------
d5d78a1  ( 366 )    kkAqk-lnk--------------tiFk---nhtiwvgpg           
d5kwqa1  ( 167 )    qlAle-qmnsv---------------------nikVgrps-nigqaqp--
d5kwqa2  ( 264 )    qdAvssMnl--------------fdl----gqyLrVgavt----------
d5lsla-  (  64 )    qyAikiMnn--------t-----vrly---drlIkVrqv           
d5o2va-  (  60 )    aaAlaaMn--------------grkimg---kevkvnwat----------
d5t9pa-  ( 146 )    miAqesMnn--------------yllm---ghlLqVrVlp----------
d5tbxb1  (  62 )    kdAmmaMng--------------ksvd---grqirvdqAg----------
d5uzga-  ( 107 )    eeArk-l--nk--asmg-------------hryIeVftAt----------
d5uzma-  ( 203 )    eqAlg-r--nr--ekig-------------hryIeIfrss----------
d5uzna-  ( 534 )    qvAmk-----rhreqMg-------------sryIeLfydg----------
d5w0ga1  ( 209 )    tqAm-afdg--------------iiFq---gqslkirrp           
d5w0ha1  ( 314 )    dqAiagln--------------gmqlg---dkkllvqr------------
d6ez7a1  ( 356 )    ekAikrynn--------------fyfr---gkkLlVtrAq-dkeera   
d6f4jc-  (  63 )    snAlrtMqg--------------fpfy---dkpMqIaySk-s--------
d6q2ia-  (  71 )    lsAmrnln--------------grefs---gralrvdn------------
d6ud7c-  ( 305 )    kkAl-qlng--------------fela---grpMkVghvt----------
d6ybso-  ( 294 )    arAiagVs--------------gfgyd---hliLnVew            
                    aaaaa                             bbbb            

                             210       220       230    
d1cvja1  (  89 )    rd                                  
d1fxla1  ( 115 )    -Arps                               
d1fxla2                                                 
d1jmta-                                                 
d1l3ka1  (  89 )    -avs                                
d1l3ka2  ( 180 )    -al                                 
d1oo0b-  ( 151 )    --vkgpk                             
d1owxa1  ( 308 )    -gevEkealkkiiedqqeslnkw--------kskgr
d1ufwa1                                                 
d1uw4a-                                                 
d1wela1  ( 507 )    -kkgMlekidmirk---------------rlq    
d1weya1  (  83 )    --------------------tlhigsshlappnpdk
d1weza1  (  91 )    tagtsg                              
d1wf2a1  (  87 )    ------------------------------epkvnr
d1whwa1  ( 116 )    ikkeasq                             
d1whxa1  ( 303 )    ----------------------kkdsqheqpaekae
d1whya1                                                 
d1wi8a1  ( 173 )    ------------------qaqdkd            
d1wwha1                                                 
d1x4da1  (  91 )    -----------------------kykri--k     
d1x4fa1  ( 101 )    -----------------------kykkl--v     
d1x4ha1  (  98 )    -avtrdeaa                           
d1x5oa1                                                 
d1zh5a2  ( 185 )    -kddyf                              
d2b0ga1                                                 
d2bz2a1  ( 110 )    -----------------------kqpm         
d2cpda1                                                 
d2cpfa1  ( 444 )    --kpa                               
d2cpia1                                                 
d2cpxa1                                                 
d2cpya1  ( 621 )    -ledmreieknppa---------------qgk    
d2cq1a1  ( 133 )    -----------------------hkelk--t     
d2cq2a1                                                 
d2cqha1  (  76 )    -----------skk---------------lrs    
d2d9pa1  ( 370 )    rkeer----------q                    
d2dgpa1  ( 135 )    -----------------------sesrggs      
d2dgsa1                                                 
d2dgta1                                                 
d2dgva1  ( 728 )    na                                  
d2dgxa1  ( 634 )    -----------------------ga           
d2dhsa2                                                 
d2disa1  (  91 )    -----------------------peidvdedvmetv
d2dita1  ( 101 )    -----------------------gttdy--q     
d2diva1  (  93 )    --------y                           
d2dnna1  ( 309 )    -erqWvaagghit                       
d2dnqa1  (  72 )    -----------------------nkska-------s
d2do4a1                                                 
d2e5ha1                                                 
d2ek1a1                                                 
d2fc8a1  (  91 )    pk----------gegg                    
d2fc9a1  (  90 )    pr----------gspn                    
d2ghpa1  ( 195 )    -----------pl                       
d2ghpa2                                                 
d2ghpa3                                                 
d2km8c2  ( 320 )    pr-------------h                    
d2krra1  (  84 )    ----------------------------------gk
d2krra2  ( 170 )    -----------------------g            
d2la4a1  ( 413 )    -----------------------er           
d2la6a1                                                 
d2lmia1  (  91 )    -nedvdalmkslq------------------vkssp
d2lxia-  (  82 )    -----------pkp---------------kinedwl
d2mqma-  ( 276 )    d----------------qdtwDytnpnlsGqg    
d2mzqa1  ( 426 )    rd                                  
d2mzra1                                                 
d2mzsa1  ( 336 )    -kes----------vhnhsdgdd--vdipmddspvn
d2n3la1                                                 
d2pe8a1  ( 389 )    -ldkFrv--ldLaeqv                    
d2roka1  ( 502 )    -yaeyvgkkqkgkqvk                    
d2rs8a1                                                 
d2rvja1  ( 525 )    -aeeMnfvlm--------------------ggtlnr
d2x1fa1  (  96 )    --------nsdisgVs                    
d2xsfa-                                                 
d2ytca1                                                 
d2ywka1                                                 
d3b4da-                                                 
d3egna-                                                 
d3feyb-  ( 118 )    gfk-------egrqyg                    
d3jb9y2  ( 255 )    -qarnqrrleeraanavkkllpkqflldleetkngk
d3lqva-  ( 102 )    dtkkkeeqlkllkekygintdppk            
d3md1a1  ( 240 )    k                                   
d3mdfa-                                                 
d3n9uc-  ( 162 )    ----------rqnlsqFeaAkrec            
d3r27a-  ( 176 )    -----------------------sqkis        
d3rw7a1                                                 
d3u1la2                                                 
d3ulha-  ( 183 )    s                                   
d3zzza-  ( 270 )    ------------------dsrDytrp----dlpsgd
d4a8xa1  ( 238 )    vlapwpr                             
d4ch0s1  ( 110 )    -ayl---gAkprtnvq                    
d4ckoa2  ( 430 )    dfgnsplhrfkpgs                      
d4ckoa3                                                 
d4f25a1                                                 
d4iufa-  ( 178 )    -pn                                 
d4ljma-                                                 
d4uqta-  ( 107 )    tfyrpkr                             
d4yuda1                                                 
d4zkaa-  (  85 )    a                                   
d5d78a1                                                 
d5kwqa1  ( 197 )    -iidq                               
d5kwqa2  ( 288 )    pppllt                              
d5lsla-                                                 
d5o2va-  (  83 )    -----------------------tps-s--qkkdts
d5t9pa-  ( 169 )    kgakIeklykykkrvl                    
d5tbxb1  (  85 )    kssdnrsr                            
d5uzga-  ( 129 )    -pkeakeamr                          
d5uzma-  ( 225 )    -iaeMkrat                           
d5uzna-  ( 556 )    kt                                  
d5w0ga1                                                 
d5w0ha1  ( 335 )    -as                                 
d6ez7a1                                                 
d6f4jc-  (  87 )    -dsdivakik                          
d6q2ia-  (  92 )    -aaseknkeelkslgt                    
d6ud7c-  ( 328 )    ---------------e                    
d6ybso-

Domains
Outliers

Domain ID	Name	Family	Source	STRING-DB
d1cvja1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1cvja1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Poly(A)-binding protein	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d1fxla1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1fxla1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Hu antigen D (Hud)	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d1fxla2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1fxla2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Hu antigen D (Hud)	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d1jmta- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1jmta- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	U2AF35 (35 KDa subunit)	Splicing factor U2AF subunits	Human (Homo sapiens) [TaxId: 9606]	view
d1l3ka1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1l3ka1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Nuclear ribonucleoprotein A1 (RNP A1, UP1)	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d1l3ka2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1l3ka2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Nuclear ribonucleoprotein A1 (RNP A1, UP1)	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d1oo0b- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1oo0b- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	RNA-binding protein 8	Canonical RBD	Fruit fly (Drosophila melanogaster) [TaxId: 7227]	view
d1owxa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1owxa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Lupus LA protein	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d1ufwa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1ufwa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Synaptojanin 2	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d1uw4a- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1uw4a- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	RNA processing protein UPF3x, RRM domain	Smg-4/UPF3	Human (Homo sapiens) [TaxId: 9606]	view
d1wela1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1wela1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	RNA-binding protein 12	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d1weya1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1weya1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Calcipressin-1	Canonical RBD	Mouse (Mus musculus) [TaxId: 10090]	view
d1weza1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1weza1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Heterogeneous nuclear ribonucleoprotein H'	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d1wf2a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1wf2a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Heterogeneous nuclear ribonucleoproteins C1/C2	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d1whwa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1whwa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Probable RNA-binding protein 19, Rbm19	Canonical RBD	Mouse (Mus musculus) [TaxId: 10090]	view
d1whxa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1whxa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Probable RNA-binding protein 19, Rbm19	Canonical RBD	Mouse (Mus musculus) [TaxId: 10090]	view
d1whya1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1whya1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Putative RNA-binding protein 15B, Rbm15b	Canonical RBD	Mouse (Mus musculus) [TaxId: 10090]	view
d1wi8a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1wi8a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Eukaryotic translation initiation factor 4B	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d1wwha1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1wwha1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Nucleoporin 35	Canonical RBD	Mouse (Mus musculus) [TaxId: 10090]	view
d1x4da1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1x4da1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Matrin 3	Canonical RBD	Mouse (Mus musculus) [TaxId: 10090]	view
d1x4fa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1x4fa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Matrin 3	Canonical RBD	Mouse (Mus musculus) [TaxId: 10090]	view
d1x4ha1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1x4ha1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	RNA-binding protein 28	Canonical RBD	Mouse (Mus musculus) [TaxId: 10090]	view
d1x5oa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1x5oa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	RNA-binding motif, single-stranded-interacting protein 1, RBMS1	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d1zh5a2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1zh5a2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Lupus LA protein	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2b0ga1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2b0ga1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Splicesomal U1A protein	Canonical RBD	Fruit fly (Drosophila melanogaster) [TaxId: 7227]	view
d2bz2a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2bz2a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Negative elongation factor E, NELF-E	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2cpda1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2cpda1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	APOBEC1 stimulating protein	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2cpfa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2cpfa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Probable RNA-binding protein 19, Rbm19	Canonical RBD	Mouse (Mus musculus) [TaxId: 10090]	view
d2cpia1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2cpia1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	E3 ubiquitin protein ligase CNOT4	Canonical RBD	Mouse (Mus musculus) [TaxId: 10090]	view
d2cpxa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2cpxa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	RNA-binding protein 41, RBM41	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2cpya1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2cpya1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	RNA-binding protein 12	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2cq1a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2cq1a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Polypyrimidine tract-binding protein 2, PTBP2	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2cq2a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2cq2a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Alkylation repair AlkB homolog 8, ALKBH8	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2cqha1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2cqha1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	IGF-II mRNA-binding protein 2 isoform A	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2d9pa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2d9pa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2dgpa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2dgpa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2dgsa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2dgsa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2dgta1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2dgta1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2dgva1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2dgva1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2dgxa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2dgxa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Limkain-b1, LKAP	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2dhsa2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2dhsa2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2disa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2disa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Hypothetical protein FLJ20273	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2dita1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2dita1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	HIV Tat-specific factor 1	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2diva1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2diva1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2dnna1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2dnna1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	RNA-binding protein 12	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2dnqa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2dnqa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2do4a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2do4a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2e5ha1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2e5ha1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2ek1a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2ek1a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2fc8a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2fc8a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2fc9a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2fc9a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2ghpa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2ghpa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	U4/U6 snRNA-associated-splicing factor PRP24	Canonical RBD	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]	view
d2ghpa2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2ghpa2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	U4/U6 snRNA-associated-splicing factor PRP24	Canonical RBD	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]	view
d2ghpa3 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2ghpa3 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	U4/U6 snRNA-associated-splicing factor PRP24	Canonical RBD	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]	view
d2km8c2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2km8c2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]	view
d2krra1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2krra1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Nucleolin	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2krra2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2krra2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Nucleolin	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d2la4a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2la4a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]	view
d2la6a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2la6a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2lmia1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2lmia1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2lxia- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2lxia- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2mqma- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2mqma- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Norway rat (Rattus norvegicus) [TaxId: 10116]	view
d2mzqa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2mzqa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]	view
d2mzra1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2mzra1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]	view
d2mzsa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2mzsa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]	view
d2n3la1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2n3la1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Plasmodium falciparum [TaxId: 36329]	view
d2pe8a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2pe8a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2roka1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2roka1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	Canonical RBD	Mouse (Mus musculus) [TaxId: 10090]	view
d2rs8a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2rs8a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Non-POU domain-containing octamer-binding protein, NonO	Canonical RBD	Mouse (Mus musculus) [TaxId: 10090]	view
d2rvja1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2rvja1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2x1fa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2x1fa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]	view
d2xsfa- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2xsfa- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Mouse (Mus musculus) [TaxId: 10090]	view
d2ytca1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2ytca1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d2ywka1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2ywka1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d3b4da- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3b4da- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d3egna- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3egna- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d3feyb- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3feyb- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	CBP20, 20KDa nuclear cap-binding protein	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d3jb9y2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3jb9y2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, RRM domain	Canonical RBD	Schizosaccharomyces pombe 972h- [TaxId: 284812]	view
d3lqva- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3lqva- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d3md1a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3md1a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]	view
d3mdfa- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3mdfa- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d3n9uc- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3n9uc- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d3r27a- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3r27a- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d3rw7a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3rw7a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d3u1la2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3u1la2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, RRM domain	Canonical RBD	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]	view
d3ulha- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3ulha- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d3zzza- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3zzza- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d4a8xa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4a8xa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d4ch0s1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4ch0s1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	Canonical RBD	Nematode (Caenorhabditis elegans) [TaxId: 6239]	view
d4ckoa2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4ckoa2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d4ckoa3 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4ckoa3 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d4f25a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4f25a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d4iufa- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4iufa- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d4ljma- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4ljma- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d4uqta- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4uqta- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]	view
d4yuda1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4yuda1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d4zkaa- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4zkaa- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d5d78a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d5d78a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]	view
d5kwqa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d5kwqa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d5kwqa2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d5kwqa2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d5lsla- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d5lsla- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]	view
d5o2va- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d5o2va- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d5t9pa- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d5t9pa- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]	view
d5tbxb1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d5tbxb1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d5uzga- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d5uzga- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Fruit fly (Drosophila melanogaster) [TaxId: 7227]	view
d5uzma- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d5uzma- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Fruit fly (Drosophila melanogaster) [TaxId: 7227]	view
d5uzna- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d5uzna- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Fruit fly (Drosophila melanogaster) [TaxId: 7227]	view
d5w0ga1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d5w0ga1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Splicing factor U2AF 65 KDa subunit	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d5w0ha1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d5w0ha1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Splicing factor U2AF 65 KDa subunit	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d6ez7a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d6ez7a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]	view
d6f4jc- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d6f4jc- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	Canonical RBD	Fruit fly (Drosophila melanogaster) [TaxId: 7227]	view
d6q2ia- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d6q2ia- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Cleavage stimulation factor, 64 kda subunit	Canonical RBD	Human (Homo sapiens) [TaxId: 9606]	view
d6ud7c- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d6ud7c- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d6ybso- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d6ybso- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view

Domain ID	Name
d1u6fa1	1u6f A:1-139
d1x4ea1	1x4e A:8-79
d1x4ga1	1x4g A:8-103
d5gmka-	5gmk a:
d5lj3n1	5lj3 N:204-324
d3v4ma1	3v4m A:372-475
d2leba-	2leb A:
d3ue2a1	3ue2 A:443-559
d5x3ya1	5x3y A:109-200
d3begb-	3beg B:
d2e29a1	2e29 A:8-92
d2cpha1	2cph A:454-547
d3md3a1	3md3 A:75-159
d3d2wa1	3d2w A:192-261
d3h2ve1	3h2v E:59-130

Feature	Download
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

									10										20										30										40										50										60										70										80										90										100										110										120										130										140										150										160										170										180										190										200										210										220										230
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	-	-	-	-	-	-	-	S	L	Y	V	G	-	-	D	L	H	-	P	D	V	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	A	M	L	Y	-	-	E	K	F	S	P	A	-	G	-	-	-	-	-	-	-	-	P	I	L	S	I	R	V	C	R	D	M	-	-	-	I	T	-	R	R	S	L	G	Y	A	Y	V	N	F	Q	Q	-	P	A	D	A	E	R	A	L	D	T	M	N	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	V	I	K	-	-	-	G	K	P	V	R	I	M	W	S	Q	-	-	-	-	-	-	-	-	-	-	R	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	K	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	L	I	V	N	-	-	Y	L	P	-	Q	N	M	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	E	E	F	R	-	-	S	L	F	G	S	I	-	G	-	-	-	-	-	-	-	-	E	I	E	S	C	K	L	V	R	D	K	-	-	-	I	T	-	G	Q	S	L	G	Y	G	F	V	N	Y	I	D	-	P	K	D	A	E	K	A	I	N	T	L	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	L	R	L	Q	-	-	-	T	K	T	I	K	V	S	Y	-	-	-	-	-	-	-	-	-	-	-	-	-	A	R	P	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	A	S	I	-	R	D	-	-	-	A	-	-	-	-	-	-	-	N	L	Y	V	S	-	-	G	L	P	-	K	T	M	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	K	E	L	E	-	-	Q	L	F	S	Q	Y	-	G	-	-	-	-	-	-	-	-	R	I	I	T	S	R	I	L	V	D	Q	-	-	-	V	T	-	G	V	S	R	G	V	G	F	I	R	F	D	K	-	R	I	E	A	E	E	A	I	K	G	L	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	K	P	S	-	G	A	T	E	P	I	T	V	K	F	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	Q	-	-	-	-	-	-	-	T	I	A	L	L	-	-	N	I	Y	R	N	P	Q	D	G	L	R	S	A	V	S	D	V	E	M	-	-	-	-	-	-	-	-	Q	-	-	-	-	-	-	-	E	H	Y	D	E	F	F	E	E	V	F	-	-	T	E	M	E	E	K	Y	G	-	-	-	-	-	-	-	-	E	V	E	E	M	N	V	C	D	N	-	-	-	L	-	-	G	D	H	L	V	G	N	V	Y	V	K	F	R	R	-	E	E	D	A	E	K	A	V	I	D	L	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	R	W	F	N	G	-	-	-	Q	P	I	H	A	E	L	S	P	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	E	P	E	Q	L	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	L	F	I	G	-	-	G	L	S	-	F	E	T	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	E	S	L	R	-	-	S	H	F	E	Q	W	-	G	-	-	-	-	-	-	-	-	T	L	T	D	C	V	V	M	R	D	P	-	-	-	N	T	-	K	R	S	R	G	F	G	F	V	T	Y	A	T	-	V	E	E	V	D	A	A	M	N	-	A	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	P	H	K	V	D	-	-	-	G	R	V	V	E	P	K	R	-	-	-	-	-	-	-	-	-	-	-	-	-	A	V	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	V	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	I	F	V	G	-	-	G	I	K	-	E	D	T	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	H	H	L	R	-	-	D	Y	F	E	Q	Y	-	G	-	-	-	-	-	-	-	-	K	I	E	V	I	E	I	M	T	D	R	-	-	-	G	S	-	G	K	K	R	G	F	A	F	V	T	F	D	D	-	H	D	S	V	D	K	I	V	I	Q	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Y	H	T	V	N	-	-	-	G	H	N	C	E	V	R	K	-	-	-	-	-	-	-	-	-	-	-	-	-	A	L	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	P	G	P	Q	R	S	V	E	G	-	-	-	W	-	-	-	-	-	-	-	I	L	F	V	T	-	-	S	I	H	-	E	E	A	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	D	E	I	Q	-	-	E	K	F	C	D	Y	-	G	-	-	-	-	-	-	-	-	E	I	K	N	I	H	L	N	L	D	R	-	-	-	R	T	-	G	F	S	K	G	Y	A	L	V	E	Y	E	T	-	H	K	Q	A	L	A	A	K	E	A	L	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	E	I	M	-	-	-	G	Q	T	I	Q	V	D	W	C	F	-	-	-	-	-	-	-	-	-	-	-	-	V	K	G	P	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	L	E	E	K	I	G	C	L	L	K	F	S	G	D	L	D	D	Q	T	C	R	E	D	L	H	-	-	I	L	F	S	N	-	-	-	-	-	-	-	-	-	-	-	H	G	E	I	K	W	I	D	F	V	R	G	A	-	-	-	-	-	-	-	K	E	G	I	I	L	F	K	E	K	A	K	E	A	L	G	K	A	K	D	A	N	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	N	L	Q	L	R	N	-	-	K	E	V	T	W	E	V	L	E	-	-	-	-	-	-	-	-	-	-	-	G	E	V	E	K	E	A	L	K	K	I	I	E	D	Q	Q	E	S	L	N	K	W	-	-	-	-	-	-	-	-	K	S	K	G	R
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	S	F	Q	G	P	L	D	A	T	V	V	V	N	L	Q	S	P	T	-	L	-	-	-	-	-	-	-	-	-	-	-	E	E	K	-	-	-	-	-	-	-	-	N	-	-	-	-	-	-	-	E	F	P	E	D	L	R	T	E	L	M	-	-	Q	T	L	G	S	Y	G	-	-	-	-	-	-	-	-	T	-	-	I	V	L	V	R	I	N	-	-	-	-	-	-	-	-	-	-	-	Q	G	Q	M	L	V	T	F	A	D	-	S	H	S	A	L	S	V	L	D	-	V	-	-	D	G	-	-	M	K	V	K	-	-	-	-	-	-	-	-	-	-	-	-	-	G	R	A	V	K	I	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	L	S	-	-	-	K	V	V	I	R	-	-	R	L	P	-	P	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	L	T	K	E	Q	L	Q	-	-	E	H	L	Q	P	M	-	P	-	-	-	-	-	-	-	-	E	H	D	Y	F	E	F	F	S	-	-	N	D	T	S	L	Y	P	H	M	Y	A	R	A	Y	I	N	F	K	N	-	Q	E	D	I	I	L	F	R	D	R	F	D	G	Y	V	-	F	L	D	N	K	G	-	-	-	-	-	-	-	-	-	-	-	Q	E	Y	P	A	I	V	E	F	A	P	-	F	Q	K	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	S	G	S	S	G	K	S	P	S	G	Q	K	R	S	R	S	R	S	P	H	E	-	-	-	-	-	A	G	F	C	V	Y	L	K	-	-	G	L	P	-	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	A	E	-	-	-	N	K	H	V	I	-	-	D	F	F	K	K	L	D	-	-	I	V	E	-	-	-	-	-	-	D	S	I	Y	I	A	Y	G	P	N	-	-	-	-	-	G	K	A	T	G	E	G	F	V	E	F	R	N	-	E	A	D	Y	K	A	A	L	C	-	R	-	-	H	K	-	-	Q	Y	M	G	-	-	-	-	-	-	-	-	-	-	-	-	-	N	R	F	I	Q	V	H	P	I	T	-	-	-	-	-	-	-	-	-	-	-	K	K	G	M	L	E	K	I	D	M	I	R	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	L	Q	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	L	I	A	C	-	-	V	A	N	-	D	D	V	F	S	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	E	T	R	A	K	F	E	-	-	S	L	F	R	T	Y	D	K	-	-	-	-	-	-	-	-	-	D	T	T	F	Q	Y	F	K	S	-	-	-	-	-	-	-	-	-	-	F	K	R	V	R	I	N	F	S	N	-	P	L	S	A	A	D	A	R	L	R	L	H	K	T	E	-	F	L	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	E	M	K	L	Y	F	A	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	L	H	I	G	S	S	H	L	A	P	P	N	P	D	K
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	S	F	Q	S	T	T	G	H	C	V	H	M	R	-	-	G	L	P	-	Y	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	A	T	-	-	-	E	N	D	I	Y	-	-	N	F	F	S	P	-	L	-	N	P	M	-	-	-	-	-	-	-	-	R	V	H	I	E	I	G	P	-	-	-	-	-	D	G	R	V	T	G	E	A	D	V	E	F	A	T	-	H	E	D	A	V	A	A	M	A	-	-	-	-	-	K	D	K	A	N	M	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	H	R	Y	V	E	L	F	L	N	S	-	-	-	-	-	-	-	-	-	-	T	A	G	T	S	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	T	D	P	R	S	M	N	S	-	-	-	-	-	-	-	R	V	F	I	G	-	-	N	L	N	T	L	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	V	V	K	K	S	D	V	E	-	-	A	I	F	S	K	-	Y	G	-	-	-	-	-	-	-	-	K	I	V	G	C	S	V	H	K	-	-	-	-	-	-	-	-	-	-	-	-	G	F	A	F	V	Q	Y	V	N	-	E	R	N	A	R	A	A	V	A	G	E	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	R	M	I	A	G	-	-	-	Q	V	L	D	I	N	L	A	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	P	K	V	N	R
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	-	-	-	G	-	-	-	-	-	-	-	R	L	F	V	R	-	-	N	L	S	-	Y	T	S	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	D	L	E	-	-	K	L	F	S	A	Y	-	G	-	-	-	-	-	-	-	-	P	L	S	E	L	H	Y	P	I	D	S	-	-	-	L	T	-	K	K	P	K	G	F	A	F	V	T	F	M	F	-	P	E	H	A	V	K	A	Y	A	E	V	D	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	V	F	Q	-	-	-	G	R	M	L	H	V	L	P	S	T	-	-	-	-	-	-	-	-	-	-	I	K	K	E	A	S	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	S	K	T	-	-	-	-	-	-	-	V	I	L	A	K	-	-	N	L	P	-	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	T	L	A	A	E	I	Q	-	-	E	T	F	S	R	F	G	S	-	-	-	-	-	-	-	-	-	L	G	R	V	L	L	P	-	-	E	-	-	-	-	-	-	G	-	-	G	I	T	A	I	V	E	F	L	E	-	P	L	E	A	R	K	A	F	R	H	L	A	Y	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	F	H	H	-	-	-	V	P	L	Y	L	E	W	A	P	-	I	G	V	F	G	A	A	P	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	K	D	S	Q	H	E	Q	P	A	E	K	A	E
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	I	G	Y	G	K	A	N	-	P	T	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	L	W	V	G	-	-	G	L	G	-	P	-	-	-	-	-	-	-	-	-	N	T	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	L	A	A	L	A	-	-	R	E	F	D	R	F	G	-	-	-	-	-	-	-	-	-	S	I	R	T	I	D	H	V	K	-	-	-	-	-	-	-	-	-	-	G	D	S	F	A	Y	I	Q	Y	E	S	-	L	D	A	A	Q	A	A	C	A	K	M	R	G	F	P	-	L	G	G	P	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	R	L	R	V	D	F	A	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	R	L	P	K	S	P	P	-	-	-	Y	-	-	-	-	-	-	-	T	A	F	L	G	-	-	N	L	P	-	Y	D	V	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	S	I	K	-	-	E	F	F	R	-	-	-	-	-	-	-	-	-	-	G	L	N	I	S	A	V	R	L	P	R	E	P	-	-	-	S	N	P	E	R	L	K	G	F	G	Y	A	E	F	E	D	-	L	D	S	L	L	S	A	L	S	-	L	N	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	S	L	G	-	-	-	N	K	R	I	R	V	D	V	A	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	A	Q	D	K	D	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	H	L	D	D	T	-	-	-	W	V	T	V	F	-	-	G	F	P	-	Q	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	A	S	Y	I	L	-	-	L	Q	F	A	Q	Y	-	G	-	-	-	-	-	-	-	-	N	I	L	K	H	V	M	S	N	-	-	-	-	-	-	-	-	-	-	T	G	N	W	M	H	I	R	Y	Q	S	-	K	L	Q	A	R	K	A	L	S	-	K	D	G	R	I	-	F	G	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	I	M	I	G	V	K	P	C	I	-	D	K	N	V	M	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	K	G	-	-	-	-	-	-	-	-	-	-	-	-	R	V	E	T	R	R	-	-	-	-	-	-	-	V	V	H	I	M	-	-	D	F	Q	R	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	N	L	R	Y	Q	L	L	-	-	Q	L	V	E	P	-	F	G	-	-	-	-	-	-	-	-	V	I	S	N	H	L	I	L	N	-	-	-	-	-	-	-	-	-	-	K	I	N	E	A	F	I	E	M	A	T	-	T	E	D	A	Q	A	A	V	D	Y	Y	T	T	T	-	-	-	-	-	-	-	-	-	-	-	-	P	A	L	V	F	G	-	-	-	K	P	V	R	V	H	L	S	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	Y	K	R	I	-	-	K	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	K	P	E	G	K	P	D	Q	K	F	D	Q	K	Q	-	-	E	L	G	R	-	-	-	-	-	-	-	V	I	H	L	S	-	-	N	L	P	H	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	Y	S	D	S	A	V	L	-	-	K	L	A	E	P	-	Y	G	-	-	-	-	-	-	-	-	K	I	K	N	Y	I	L	M	R	-	-	-	-	-	-	-	-	-	-	M	K	S	Q	A	F	I	E	M	E	T	-	R	E	D	A	M	A	M	V	D	H	C	L	K	K	-	-	-	-	-	-	-	-	-	-	-	-	A	L	W	F	Q	G	-	-	-	R	C	V	K	V	D	L	S	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	Y	K	K	L	-	-	V	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	L	P	S	D	V	T	E	G	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	V	F	I	R	-	-	N	L	S	-	F	D	S	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	A	L	G	-	-	E	V	L	Q	Q	F	-	G	-	-	-	-	-	-	-	-	D	L	K	Y	V	R	V	V	L	H	P	-	-	-	D	T	-	E	H	S	K	G	C	A	F	A	Q	F	M	T	-	Q	E	A	A	Q	K	C	L	A	A	A	S	L	-	-	-	-	-	-	-	-	E	A	E	G	G	G	L	K	L	D	-	-	-	G	R	Q	L	K	V	D	L	-	-	-	-	-	-	-	-	-	-	-	-	-	A	V	T	R	D	E	A	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	L	K	A	S	G	V	Q	A	Q	M	A	K	Q	Q	E	Q	-	-	-	-	D	P	T	N	L	Y	I	S	-	-	N	L	P	-	L	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	M	D	-	-	-	E	Q	E	L	E	-	-	N	M	L	K	P	F	G	-	Q	V	I	-	-	-	-	-	-	-	-	S	T	R	I	L	R	D	S	-	-	-	-	-	S	G	T	S	R	G	V	G	F	A	R	M	E	S	-	T	E	K	C	E	A	V	I	G	H	F	-	-	N	G	K	F	I	K	T	P	P	G	V	S	-	-	-	-	-	-	-	A	P	T	E	P	L	L	C	K	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Y	K	N	D	V	K	N	R	S	V	Y	I	K	-	-	G	F	P	-	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	A	T	-	-	-	L	D	D	I	K	-	-	E	W	L	E	D	K	G	-	Q	V	L	-	-	-	-	-	-	-	-	N	I	Q	-	R	R	T	L	-	-	-	-	-	H	K	A	F	K	G	S	I	F	V	V	F	D	S	-	I	E	S	A	K	K	F	V	E	-	-	-	-	-	T	P	G	Q	K	Y	K	-	-	-	-	-	-	-	-	-	-	-	-	-	E	T	D	L	L	I	L	F	-	-	-	-	-	-	-	-	-	-	-	-	-	K	D	D	Y	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	Q	T	-	-	-	-	-	-	-	-	-	-	E	Q	P	P	N	Q	-	-	-	-	-	-	-	I	L	F	L	T	-	-	N	L	P	-	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	T	N	E	M	M	L	S	-	-	M	L	F	N	Q	F	P	-	-	-	-	-	-	-	-	-	G	F	K	E	V	R	L	V	P	-	-	-	-	-	-	-	-	-	N	R	H	D	I	A	F	V	E	F	T	T	-	E	L	Q	S	N	A	A	K	E	A	L	Q	G	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	I	T	P	T	-	-	H	A	M	K	I	T	F	A	K	-	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	P	R	K	G	N	-	-	-	-	-	-	-	T	L	Y	V	Y	-	-	G	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	M	T	P	T	L	L	R	-	-	G	A	F	S	P	-	F	G	-	-	-	-	-	-	-	-	N	I	I	D	L	S	M	D	P	P	-	-	-	R	-	-	-	-	-	-	-	N	C	A	F	V	T	Y	E	K	-	M	E	S	A	D	Q	A	V	A	E	L	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	T	Q	V	E	S	-	-	-	V	Q	L	K	V	N	I	A	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	Q	P	M	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	E	D	T	M	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	S	V	K	-	-	-	-	-	-	-	I	L	Y	V	R	-	-	N	L	M	-	L	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	T	S	E	E	M	I	E	-	-	K	E	F	N	N	I	K	P	-	-	-	-	-	-	-	G	A	V	E	R	V	K	K	I	-	-	R	-	-	-	-	-	-	-	-	-	-	D	Y	A	F	V	H	F	S	N	-	R	E	D	A	V	E	A	M	K	A	L	N	G	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	V	L	D	G	-	-	-	S	P	I	E	V	T	L	A	K	-	P	V	-	-	D	K	D	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	L	F	I	K	-	-	N	L	N	-	F	-	-	-	-	-	-	-	-	-	S	T	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	T	L	K	-	-	G	V	F	S	K	V	G	-	-	-	-	-	-	-	-	-	A	I	K	S	C	T	I	S	K	K	K	N	K	A	G	-	V	L	L	S	M	G	F	G	F	V	E	Y	K	K	-	P	E	Q	A	Q	K	A	L	K	Q	L	Q	G	H	T	-	V	D	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	H	K	L	E	V	R	I	S	E	-	R	A	T	-	-	-	-	-	-	-	-	K	P	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	S	V	R	V	V	Q	K	N	L	V	F	V	V	G	L	S	Q	R	L	A	D	P	E	V	L	K	R	P	E	Y	F	G	K	F	G	-	-	-	-	-	-	-	-	-	K	I	H	K	V	V	I	N	N	S	T	S	Y	A	-	G	S	Q	G	P	S	A	S	A	Y	V	T	Y	I	R	-	S	E	D	A	L	R	A	I	Q	C	V	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	V	V	V	D	-	-	-	G	R	T	L	K	A	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	I	R	K	I	P	M	F	S	S	Y	N	P	G	E	P	N	-	-	-	K	-	-	-	-	-	-	-	V	L	Y	L	K	-	-	N	L	S	-	P	R	V	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	R	D	L	V	-	-	S	L	F	A	R	F	Q	E	K	-	-	-	-	-	K	G	P	P	I	Q	F	R	M	M	-	T	-	-	-	-	-	-	G	-	R	M	R	G	Q	A	F	I	T	F	P	N	-	K	E	I	A	W	Q	A	L	H	L	V	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Y	K	L	Y	-	-	-	G	K	I	L	V	I	E	F	G	K	-	N	K	K	Q	R	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	G	D	V	N	S	A	K	V	C	A	H	I	T	-	-	N	I	P	-	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	I	T	-	-	-	K	M	D	V	L	-	-	Q	F	L	E	G	I	P	-	-	V	D	E	-	-	-	-	-	-	N	A	V	H	V	L	V	D	N	N	-	-	-	-	-	G	Q	G	L	G	Q	A	L	V	Q	F	K	N	-	E	D	D	A	R	K	S	E	R	-	L	-	-	H	R	-	-	K	K	L	N	-	-	-	-	-	-	-	-	-	-	-	-	-	G	R	E	A	F	V	H	V	V	T	-	-	-	-	-	-	-	-	-	-	-	L	E	D	M	R	E	I	E	K	N	P	P	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	G	K	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	K	M	D	G	A	P	S	R	-	-	-	-	-	-	-	V	L	H	I	R	-	-	K	L	P	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	V	T	E	T	E	V	I	-	-	A	L	G	L	P	-	F	G	-	-	-	-	-	-	-	-	K	V	T	N	I	L	M	L	K	-	-	-	-	-	-	-	-	-	-	G	K	N	Q	A	F	L	E	L	A	T	-	E	E	A	A	I	T	M	V	N	Y	Y	S	A	V	-	-	-	-	-	-	-	-	-	-	-	-	T	P	H	L	R	N	-	-	-	Q	P	I	Y	I	Q	Y	S	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	H	K	E	L	K	-	-	T	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	K	H	T	L	L	R	H	E	G	I	E	T	V	S	Y	A	T	Q	-	-	-	-	-	-	-	S	L	V	V	A	-	-	N	G	G	-	L	G	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	V	S	R	N	Q	L	L	-	-	P	V	L	E	K	C	G	-	-	-	-	-	-	-	-	-	L	V	D	A	L	L	M	P	P	-	-	-	-	-	-	-	-	-	N	-	K	P	Y	S	F	A	R	Y	R	T	-	T	E	E	S	K	R	A	Y	V	T	L	N	G	K	-	-	-	-	-	-	-	-	-	-	-	-	E	V	V	D	D	L	G	Q	K	I	T	L	Y	L	N	F	V	E	-	K	V	Q	W	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	N	K	L	Y	I	G	-	-	N	L	S	-	P	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	V	T	-	-	-	A	D	D	L	R	-	-	Q	L	F	G	D	R	K	L	P	L	A	-	-	-	-	-	-	-	G	Q	V	L	L	K	-	-	-	-	-	-	-	-	-	-	-	-	S	G	Y	A	F	V	D	Y	P	D	-	Q	N	W	A	I	R	A	I	E	T	L	-	-	S	G	-	K	V	E	L	H	-	-	-	-	-	-	-	-	-	-	-	-	-	G	K	I	M	E	V	D	Y	S	V	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	K	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	L	R	S	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	R	I	T	R	Y	Q	V	-	-	-	V	-	-	-	-	-	-	-	N	L	Y	V	K	-	-	N	L	D	-	D	G	I	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	E	R	L	R	-	-	K	A	F	S	P	F	-	G	-	-	-	-	-	-	-	-	T	I	T	S	A	K	V	M	M	E	G	-	-	-	-	-	-	G	R	S	K	G	F	G	F	V	C	F	S	S	-	P	E	E	A	T	K	A	V	T	E	M	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	I	V	A	-	-	-	T	K	P	L	Y	V	A	L	A	Q	-	-	-	-	-	-	-	-	-	-	R	K	E	E	R	-	-	-	-	-	-	-	-	-	-	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	-	-	-	K	D	H	D	A	I	-	-	-	-	-	-	-	K	L	F	I	G	-	-	Q	I	P	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	L	D	E	K	D	L	K	-	-	P	L	F	E	E	F	G	-	-	-	-	-	-	-	-	-	K	I	Y	E	L	T	V	L	K	D	R	F	T	G	-	-	-	-	M	H	K	G	C	A	F	L	T	Y	C	E	-	R	E	S	A	L	K	A	Q	S	A	L	H	E	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	K	T	L	P	G	-	M	N	R	P	I	Q	V	K	P	A	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	E	S	R	G	G	S	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	K	S	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	I	F	V	G	-	-	G	I	P	-	H	-	-	-	-	-	-	-	-	-	N	C	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	T	E	L	R	-	-	E	Y	F	K	K	F	G	-	-	-	-	-	-	-	-	-	V	V	T	E	V	V	M	I	Y	D	-	-	-	A	E	-	K	Q	R	P	R	G	F	G	F	I	T	F	E	D	-	E	Q	S	V	D	Q	A	V	N	-	M	H	F	H	D	-	I	M	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	K	V	E	V	K	R	A	E	-	P	R	D	S	K	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	A	S	T	-	-	-	-	-	-	-	K	L	H	V	G	-	-	N	I	S	-	P	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	C	T	N	Q	E	L	R	-	-	A	K	F	E	E	Y	G	P	-	-	-	-	-	-	-	-	-	V	I	E	C	D	I	V	-	-	K	-	-	-	-	-	-	-	-	-	-	D	Y	A	F	V	H	M	E	R	-	A	E	D	A	V	E	A	I	R	G	L	D	N	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	F	Q	G	-	-	-	K	R	M	H	V	Q	L	S	T	-	S	R	-	-	L	R	T	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	-	-	-	C	-	-	-	-	-	-	-	Q	I	F	V	R	-	-	N	L	P	-	F	D	F	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	W	K	M	L	K	-	-	D	K	F	N	E	C	-	G	-	-	-	-	-	-	-	-	H	V	L	Y	A	D	I	K	M	E	N	-	-	-	-	-	-	G	K	S	K	G	C	G	V	V	K	F	E	S	-	P	E	V	A	E	R	A	C	R	M	M	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	K	L	S	-	-	-	G	R	E	I	D	V	R	I	D	R	-	-	-	-	-	-	-	-	-	-	N	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	G	A	-	-	-	-	-	-	-	D	V	Q	V	S	-	-	N	I	D	Y	R	L	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	K	E	L	Q	Q	L	L	Q	-	-	E	A	F	A	R	-	H	G	-	-	-	-	-	-	-	-	K	V	K	S	V	E	L	S	P	H	-	-	-	T	-	-	D	Y	-	-	Q	L	K	A	V	V	Q	M	E	N	-	L	Q	D	A	I	G	A	V	N	S	L	H	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	Y	K	I	G	S	-	-	-	K	K	I	L	V	S	L	A	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	A	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	V	E	D	R	-	-	-	-	-	-	-	K	L	F	I	G	-	-	M	I	S	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	C	T	E	N	D	I	R	-	-	V	M	F	S	S	F	G	-	-	-	-	-	-	-	-	-	Q	I	E	E	C	R	I	L	R	G	P	D	G	-	-	-	-	-	L	S	R	G	C	A	F	V	T	F	T	T	-	R	A	M	A	Q	T	A	I	K	A	M	H	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	A	Q	T	M	E	G	-	C	S	S	P	M	V	V	K	F	A	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	C	-	-	-	-	-	-	-	R	L	F	I	G	-	-	G	I	P	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	K	K	R	E	E	I	L	-	-	E	E	I	A	K	V	T	E	-	-	-	-	-	-	-	-	G	V	L	D	V	I	V	Y	A	-	S	A	A	D	-	-	K	M	K	N	R	G	F	A	F	V	E	Y	E	S	-	H	R	A	A	A	M	A	R	R	K	L	M	P	G	-	-	-	-	-	-	-	-	-	-	-	-	R	I	Q	L	W	G	-	-	-	H	Q	I	A	V	D	W	A	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	P	E	I	D	V	D	E	D	V	M	E	T	V
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	P	S	R	M	R	H	E	R	-	-	-	-	-	-	-	V	V	I	I	K	-	-	N	M	F	H	P	M	-	-	-	-	-	-	-	-	D	F	E	D	D	-	-	-	-	-	-	-	-	P	-	-	-	-	-	-	-	L	V	L	N	E	I	R	E	D	L	R	-	-	V	E	C	S	K	-	F	G	-	-	-	-	-	-	-	-	Q	I	R	K	L	L	L	F	D	R	-	-	-	-	-	-	-	-	H	P	D	G	V	A	S	V	S	F	R	D	-	P	E	E	A	D	Y	C	I	Q	T	L	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	R	W	F	G	G	-	-	-	R	Q	I	T	A	Q	A	W	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	T	T	D	Y	-	-	Q	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	A	-	-	-	A	-	-	-	-	-	-	-	S	L	W	M	G	-	-	D	L	E	-	P	Y	M	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	N	F	I	S	-	-	R	A	F	A	T	M	G	E	-	-	-	-	-	-	-	-	T	V	M	S	V	K	I	I	R	N	R	-	-	-	L	T	-	G	I	P	A	G	Y	C	F	V	E	F	A	D	-	L	A	T	A	E	K	C	L	H	K	I	N	G	-	-	-	-	-	-	-	-	K	-	-	-	-	-	P	L	P	G	A	T	P	A	K	R	F	K	L	N	Y	A	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Y	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	P	L	P	I	N	P	D	D	L	-	Y	V	S	V	H	-	-	G	M	P	-	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	A	M	-	-	-	E	N	D	V	R	-	-	D	F	F	H	G	L	R	-	-	V	D	A	-	-	-	-	-	-	-	-	V	H	L	L	K	D	H	-	-	-	-	-	V	G	R	N	N	G	N	G	L	V	K	F	L	S	-	P	Q	D	T	F	E	A	L	K	-	R	-	-	N	R	-	-	M	L	M	I	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	R	Y	V	E	V	S	P	A	T	-	-	-	-	-	-	-	-	-	-	-	E	R	Q	W	V	A	A	G	G	H	I	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	V	-	-	-	-	-	-	-	K	L	F	I	G	-	-	N	L	P	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	A	T	E	Q	E	I	R	-	-	S	L	F	E	Q	-	Y	G	-	-	-	-	-	-	-	-	K	V	L	E	C	D	I	I	K	-	-	-	-	-	-	-	-	-	-	-	-	N	Y	G	F	V	H	I	E	D	-	K	T	A	A	E	D	A	I	R	N	L	H	-	-	-	-	-	-	-	-	-	-	-	-	-	-	H	Y	K	L	H	G	-	-	-	V	N	I	N	V	E	A	S	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	K	S	K	A	-	-	-	-	-	-	-	S
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	V	F	R	Y	S	T	S	L	E	K	-	-	-	H	-	-	-	-	-	-	-	K	L	F	I	S	-	-	G	L	P	-	F	S	C	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	E	E	L	E	-	-	E	I	C	K	A	H	-	G	-	-	-	-	-	-	-	-	T	V	K	D	L	R	L	V	T	N	R	-	-	-	-	A	-	G	K	P	K	G	L	A	Y	V	E	Y	E	N	-	E	S	Q	A	S	Q	A	V	M	K	M	D	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	T	I	K	-	-	-	E	N	I	I	K	V	A	I	S	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	S	G	G	L	A	P	S	K	S	-	-	-	-	-	-	-	T	V	Y	V	S	-	-	N	L	P	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	L	T	N	N	D	L	Y	-	-	R	I	F	S	K	Y	G	-	-	-	-	-	-	-	-	-	K	V	V	K	V	T	I	M	K	D	K	D	T	R	-	-	-	-	K	S	K	G	V	A	F	I	L	F	L	D	-	K	D	S	A	Q	N	C	T	R	A	I	N	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	Q	L	F	G	-	-	-	R	V	I	K	A	S	I	A	I	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	P	T	V	I	K	V	Q	-	-	N	-	P	-	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	V	S	-	-	-	I	D	E	I	L	-	-	D	F	F	Y	G	Y	Q	-	-	V	I	P	-	-	-	-	-	-	G	S	V	C	L	K	Y	N	E	K	-	-	-	-	-	-	G	P	T	G	E	-	A	V	A	F	E	S	-	R	D	E	A	T	A	A	V	I	D	L	-	-	N	D	-	-	R	P	I	G	-	-	-	-	-	-	-	-	-	-	-	-	-	S	R	K	V	K	L	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	P	N	A	R	-	S	Q	P	S	-	-	-	K	-	-	-	-	-	-	-	T	L	F	V	K	-	-	G	L	S	-	E	D	T	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	T	L	K	-	-	E	S	F	D	-	-	-	-	-	-	-	-	-	-	-	-	G	S	V	R	A	R	I	V	T	D	R	-	-	-	E	T	-	G	S	S	K	G	F	G	F	V	D	F	N	S	-	E	E	D	A	K	A	A	K	E	A	M	E	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	E	I	D	-	-	-	G	N	K	V	T	L	D	W	A	K	-	-	-	-	-	-	-	-	-	-	P	K	-	-	-	-	-	-	-	-	-	-	G	E	G	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	S	T	W	S	G	E	S	-	-	-	K	-	-	-	-	-	-	-	T	L	V	L	S	-	-	N	L	S	-	Y	S	A	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	T	L	Q	-	-	E	V	F	E	-	-	-	-	-	-	-	-	-	-	-	-	K	A	T	F	I	K	V	P	Q	N	Q	-	-	-	-	N	-	G	K	S	K	G	Y	A	F	I	E	F	A	S	-	F	E	D	A	K	E	A	L	N	S	C	N	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	E	I	E	-	-	-	G	R	A	I	R	L	E	L	Q	G	-	-	-	-	-	-	-	-	-	-	P	R	-	-	-	-	-	-	-	-	-	-	G	S	P	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	C	T	L	W	-	T	-	-	N	F	P	-	P	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	Y	T	-	-	-	Q	R	N	I	R	-	-	D	L	L	Q	D	I	N	V	V	A	L	-	-	-	-	-	-	-	-	S	I	R	L	P	-	-	-	-	-	-	-	-	-	-	-	-	R	R	F	A	Y	I	D	V	T	S	-	K	E	D	A	R	Y	C	V	E	K	L	-	-	N	G	-	-	L	K	I	E	-	-	-	-	-	-	-	-	-	-	-	-	-	G	Y	T	L	V	T	K	V	S	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	P	L	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	-	-	-	-	-	-	-	T	V	L	V	K	-	-	N	L	P	-	K	S	Y	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	N	K	V	Y	-	-	K	Y	F	K	H	C	G	P	I	-	I	-	-	-	-	-	-	-	-	H	V	D	V	A	D	S	L	-	-	-	K	K	-	-	-	N	F	R	F	A	R	I	E	F	A	R	-	Y	D	G	A	L	A	A	I	T	-	K	T	H	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	V	V	G	-	-	-	Q	N	E	I	I	V	S	H	L	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	L	E	G	R	E	I	I	R	N	L	S	T	E	L	L	D	E	N	L	L	R	-	-	E	S	F	E	G	F	G	-	-	-	-	-	-	-	-	-	S	I	E	K	I	N	I	P	-	-	-	-	-	A	-	G	Q	K	F	N	N	C	C	A	F	V	F	-	E	N	-	K	D	S	A	E	R	A	L	Q	-	-	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	S	L	L	G	-	-	-	N	R	E	I	S	V	S	L	A	D	K	K	P	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	-	-	-	G	-	-	-	-	-	-	-	K	I	F	V	G	-	-	G	I	G	-	P	D	V	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	P	K	E	F	E	-	-	E	F	F	S	Q	W	-	G	-	-	-	-	-	-	-	-	T	I	I	D	A	Q	L	M	L	D	-	-	-	-	K	D	T	G	Q	S	R	G	F	G	F	V	T	Y	D	S	-	A	D	A	V	D	R	V	C	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	K	F	I	D	F	K	D	-	-	-	R	K	I	E	I	K	R	A	E	-	-	-	-	-	-	-	-	-	-	P	R	-	-	-	-	-	-	-	-	-	-	-	-	-	H	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	T	E	P	T	T	A	F	N	L	F	V	G	-	-	N	L	N	-	F	-	-	-	-	-	-	-	-	-	-	-	N	K	S	-	-	-	-	-	-	-	-	A	-	-	-	-	-	-	-	P	E	L	-	-	-	K	T	G	I	S	-	-	D	V	F	A	K	N	D	L	A	V	V	-	-	-	-	-	-	-	-	D	V	R	I	G	M	-	-	-	-	-	-	-	-	-	-	T	R	K	F	G	Y	V	D	F	E	S	-	A	E	D	L	E	K	A	L	E	L	-	-	-	-	T	-	G	L	K	V	F	-	-	-	-	-	-	-	-	-	-	-	-	-	G	N	E	I	K	L	E	K	P	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	K
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	S	K	K	E	R	D	A	-	-	-	R	-	-	-	-	-	-	-	T	L	L	A	K	-	-	N	L	P	-	Y	K	V	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	D	E	L	K	-	-	E	V	F	E	-	-	-	-	-	-	-	-	-	-	-	-	D	A	A	E	I	R	L	V	S	K	-	-	-	-	-	-	D	G	K	S	K	G	I	A	Y	I	E	F	K	T	-	E	A	D	A	E	K	T	F	E	E	K	Q	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	E	I	D	-	-	-	G	R	S	I	S	L	Y	Y	T	G	-	E	P	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	S	Q	T	I	G	L	P	P	Q	V	N	P	Q	A	V	D	H	I	I	R	S	A	P	P	R	V	T	-	-	-	-	-	-	-	T	A	Y	I	G	-	-	N	I	P	H	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	F	A	T	E	A	D	L	I	-	-	P	L	F	Q	N	-	F	G	-	-	-	-	-	-	-	-	F	I	L	D	F	K	H	Y	P	E	-	-	-	-	-	-	-	-	-	-	K	G	C	C	F	I	K	Y	D	T	-	H	E	Q	A	A	V	C	I	V	A	L	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	F	P	F	Q	G	-	-	-	R	N	L	R	T	G	W	G	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	R	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	D	N	-	-	-	N	-	-	-	-	-	-	-	T	I	F	V	Q	-	-	G	L	G	-	E	N	V	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	I	E	S	V	A	-	-	D	Y	F	K	Q	I	G	I	I	-	K	T	N	K	K	T	G	Q	P	M	I	N	L	Y	T	D	R	-	-	-	E	T	G	-	K	L	K	G	E	A	T	V	S	F	D	D	-	P	P	S	A	K	A	A	I	D	W	F	D	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	E	F	S	-	-	-	G	N	P	I	K	V	S	F	A	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	K	L	E	E	E	V	D	D	V	F	L	I	R	A	Q	-	-	G	L	P	-	W	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	C	T	-	-	-	M	E	D	V	L	-	-	N	F	F	S	D	C	R	-	-	I	R	N	-	-	G	E	-	-	N	G	I	H	F	L	L	N	R	-	-	-	-	-	D	G	K	R	R	G	D	A	L	I	E	M	E	S	-	E	Q	D	V	Q	K	A	L	E	-	K	-	-	H	R	-	-	M	Y	M	G	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	R	Y	V	E	V	Y	E	I	N	-	-	-	-	-	-	-	-	-	-	-	N	E	D	V	D	A	L	M	K	S	L	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	V	K	S	S	P
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	N	I	V	M	L	R	-	-	M	L	P	-	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	A	T	-	-	-	E	D	D	I	R	-	-	G	Q	L	Q	S	H	G	V	Q	A	R	-	-	-	-	-	-	-	-	E	V	R	L	M	R	N	K	S	-	-	-	-	S	G	Q	S	R	G	F	A	F	V	E	F	S	H	-	L	Q	D	A	T	R	W	M	E	A	N	-	-	Q	H	-	S	L	N	I	L	-	-	-	-	-	-	-	-	-	-	-	-	-	G	Q	K	V	S	M	H	Y	S	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	P	K	P	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	I	N	E	D	W	L
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	K	I	S	R	P	G	D	S	D	D	S	R	S	V	N	S	-	-	-	V	L	L	F	T	-	-	I	L	N	-	P	I	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Y	S	I	T	T	D	V	L	Y	-	-	T	I	C	N	P	C	-	G	-	-	-	-	-	-	-	-	P	V	Q	R	I	V	I	F	R	-	-	K	-	-	-	-	-	-	-	N	G	V	Q	A	M	V	E	F	D	S	-	V	Q	S	A	Q	R	A	K	A	S	L	N	G	A	D	-	I	Y	-	-	-	S	-	-	-	-	-	-	-	-	-	-	-	G	C	C	T	L	K	I	E	Y	A	K	-	P	T	R	L	N	V	F	K	N	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	D	T	W	D	Y	T	N	P	N	L	S	G	Q	G	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	H	I	D	E	T	A	A	K	F	T	E	G	V	N	P	G	G	D	R	N	-	-	-	C	-	-	-	-	-	-	-	F	I	Y	C	S	-	-	N	L	P	-	F	S	T	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	S	D	L	F	-	-	D	L	F	G	P	I	-	G	-	-	-	-	-	-	-	-	K	I	N	N	A	E	L	K	P	Q	E	-	-	-	N	-	-	G	Q	P	T	G	V	A	V	V	E	Y	E	N	-	L	V	D	A	D	F	C	I	Q	K	L	N	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Y	N	Y	G	-	-	-	G	C	S	L	Q	I	S	Y	A	R	-	-	-	-	-	-	-	-	-	-	R	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	R	E	L	D	S	T	Y	E	E	K	V	N	R	N	Y	S	N	-	-	-	-	-	-	-	S	I	F	V	G	-	-	N	L	T	-	Y	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	S	T	P	E	D	L	T	-	-	E	F	F	S	Q	I	G	-	-	-	-	-	-	-	-	-	K	V	V	R	A	D	I	I	T	S	R	-	-	-	-	-	-	G	H	H	R	G	M	G	T	V	E	F	T	N	-	S	D	D	V	D	R	A	I	R	Q	Y	D	G	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	F	F	M	D	-	-	-	R	K	I	F	V	R	Q	D	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	V	I	V	K	-	-	N	L	P	-	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	V	N	-	-	-	W	Q	A	L	K	-	-	D	I	F	K	E	C	G	-	-	-	-	-	-	-	N	V	-	-	A	H	A	D	V	E	L	D	-	G	-	-	-	-	D	G	V	S	T	G	S	G	T	V	S	F	Y	D	-	I	K	D	L	H	R	A	I	E	K	Y	-	-	-	-	N	-	-	-	-	-	-	G	Y	S	-	-	-	-	-	-	-	I	E	G	N	V	L	D	V	K	S	-	-	-	-	-	-	-	-	-	-	-	-	-	K	E	S	-	-	-	-	-	-	-	-	-	-	V	H	N	H	S	D	G	D	D	-	-	V	D	I	P	M	D	D	S	P	V	N
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	V	I	R	E	S	V	S	R	I	Y	V	G	N	-	-	-	-	-	-	-	L	P	S	H	V	S	S	R	D	V	E	-	-	N	E	F	R	K	Y	G	-	-	-	-	-	-	-	-	-	N	I	L	K	C	D	V	K	K	T	V	S	-	-	-	-	-	-	-	-	-	G	A	A	F	A	F	I	E	F	-	E	-	D	A	R	D	A	A	D	A	I	K	E	K	D	G	C	D	F	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	N	K	L	R	V	E	V	P	F	N	A	R	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	C	P	T	K	V	V	L	L	R	N	M	G	A	G	-	-	-	L	E	E	T	K	-	-	-	C	E	K	Y	-	-	-	-	-	-	-	-	-	-	-	G	V	G	K	C	V	I	F	E	I	P	G	A	P	D	D	E	-	-	-	A	V	R	I	F	L	E	F	E	V	-	-	E	S	A	I	K	A	V	V	D	L	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	R	Y	F	-	G	G	-	-	R	V	V	K	A	C	F	Y	N	-	-	-	-	-	-	-	-	-	-	-	L	D	K	F	R	V	-	-	L	D	L	A	E	Q	V	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	P	D	L	Q	P	K	R	D	H	V	L	H	V	T	-	-	-	F	P	-	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	W	K	-	-	-	T	S	D	L	Y	-	-	Q	L	F	S	A	F	G	-	-	-	-	-	-	-	-	N	-	-	I	Q	I	S	W	I	D	-	-	-	-	-	-	-	-	-	-	-	D	T	S	A	F	V	S	L	S	Q	-	P	E	Q	V	Q	I	A	V	N	T	S	-	-	-	-	K	-	-	-	-	-	-	Y	A	E	-	-	-	-	-	-	-	-	-	-	-	S	Y	R	I	Q	T	-	-	-	-	-	-	-	-	-	-	-	-	-	Y	A	E	Y	V	G	K	K	Q	K	G	K	Q	V	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	E	K	T	F	T	Q	R	-	-	-	S	-	-	-	-	-	-	-	R	L	F	V	G	-	-	N	L	P	-	P	D	I	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	E	M	R	-	-	K	L	F	E	K	Y	G	-	-	-	-	-	-	-	-	-	K	A	G	E	V	F	I	H	K	-	-	-	-	-	-	-	-	-	-	D	K	G	F	G	F	I	R	L	E	T	-	R	T	L	A	E	I	A	K	V	E	L	D	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	P	L	R	-	-	-	G	K	Q	L	R	V	R	F	A	C	-	H	S	A	S	L	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	P	P	T	N	V	R	D	C	I	R	L	R	-	-	G	L	P	-	Y	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	A	T	-	-	-	I	E	D	I	L	-	-	D	F	L	G	E	F	A	T	D	I	R	T	-	-	-	-	-	-	H	G	V	H	M	V	L	N	H	Q	-	-	-	-	-	G	R	P	S	G	D	A	F	I	Q	M	K	S	-	A	D	R	A	F	M	A	A	Q	K	C	-	-	H	K	-	-	K	N	M	K	-	-	-	-	-	-	-	-	-	-	-	-	-	D	R	Y	V	E	V	F	Q	C	S	-	-	-	-	-	-	-	-	-	-	-	A	E	E	M	N	F	V	L	M	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	G	T	L	N	R
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	P	S	-	-	-	R	-	-	-	-	-	-	-	V	V	Y	L	G	-	-	S	I	P	-	Y	D	Q	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	Q	I	L	-	-	D	L	C	S	N	V	-	G	-	-	-	-	-	-	-	-	P	V	I	N	L	K	M	M	F	D	P	-	-	-	Q	T	-	G	R	S	K	G	Y	A	F	I	E	F	-	D	-	L	E	S	S	A	S	A	V	R	N	L	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Y	Q	L	G	-	-	-	S	R	F	L	K	C	G	Y	S	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	S	D	I	S	G	V	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	I	M	P	N	T	V	F	V	G	G	I	D	V	-	-	M	D	E	T	E	I	R	-	-	S	F	F	A	R	Y	G	-	-	-	-	-	-	-	-	-	S	V	K	E	V	K	I	I	T	D	R	-	-	-	-	-	T	G	V	S	K	G	Y	G	F	V	S	F	Y	N	-	D	V	D	V	Q	K	I	V	E	S	Q	I	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	F	H	-	-	-	-	-	G	K	K	L	K	L	G	P	A	I	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	D	K	T	I	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	L	Y	V	G	-	-	G	L	G	-	D	-	-	-	-	-	-	-	-	-	T	I	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	T	D	L	R	-	-	N	H	F	Y	Q	F	G	-	-	-	-	-	-	-	-	-	E	I	R	T	I	T	V	V	-	-	-	-	Q	R	Q	-	-	-	-	-	-	Q	C	A	F	I	Q	F	A	T	-	R	Q	A	A	E	V	A	A	E	K	S	F	N	K	L	-	I	V	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	R	R	L	N	V	K	W	G	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	E	E	A	D	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	V	F	V	G	-	-	N	L	E	-	A	-	-	-	-	-	-	-	-	-	R	V	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	I	L	Y	-	-	E	L	F	L	Q	A	G	-	-	-	-	-	-	-	-	-	P	L	T	K	V	T	I	C	K	D	-	R	-	-	-	-	E	G	K	P	K	S	F	G	F	V	C	F	K	H	-	P	E	S	V	S	Y	A	I	A	L	L	N	G	I	R	-	L	Y	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	P	I	N	V	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	D	A	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	I	Y	V	G	-	-	N	V	D	-	Y	-	-	-	-	-	-	-	-	-	G	A	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	E	E	L	E	-	-	A	H	F	H	G	C	G	-	-	-	-	-	-	-	-	-	S	V	N	R	V	T	I	L	C	D	K	F	-	-	-	-	S	G	H	P	K	G	F	A	Y	I	E	F	S	D	-	K	E	S	V	R	T	S	L	A	-	L	D	E	S	L	-	F	R	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	Q	I	K	V	I	P	K	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
E	C	I	S	R	R	E	L	E	K	G	R	I	S	R	E	E	M	E	T	L	S	V	F	R	S	Y	E	P	G	E	P	N	-	-	-	C	-	-	-	-	-	-	-	R	I	Y	V	K	-	-	N	L	A	-	K	H	V	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	K	D	L	K	-	-	Y	I	F	G	R	Y	V	D	F	-	S	S	E	T	Q	R	I	M	F	D	I	R	L	M	K	E	-	-	-	-	-	-	G	-	R	M	K	G	Q	A	F	I	G	L	P	N	-	E	K	A	A	A	K	A	L	K	E	A	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Y	V	L	F	-	-	-	G	K	P	M	V	V	Q	F	A	R	-	-	-	S	A	R	P	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	D	S	-	-	-	-	-	-	Y	V	E	E	Q	E	K	L	L	K	K	S	-	-	-	C	-	-	-	-	-	-	-	T	L	Y	V	G	-	-	N	L	S	-	F	Y	T	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	Q	I	Y	-	-	E	L	F	S	K	S	-	G	-	-	-	-	-	-	-	-	D	I	K	K	I	I	M	G	L	D	-	-	-	-	-	-	-	-	T	A	C	G	F	C	F	V	E	Y	Y	S	-	R	A	D	A	E	N	A	M	R	Y	I	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	R	L	D	-	-	-	D	R	I	I	R	T	D	W	D	A	-	-	-	-	-	-	-	-	-	-	G	F	K	-	-	-	-	-	-	-	E	G	R	Q	Y	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	N	Y	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	L	Y	V	G	-	-	G	I	T	-	P	T	-	-	-	-	-	-	-	-	D	D	I	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	I	V	S	-	-	R	H	F	A	E	W	G	-	-	-	-	-	-	-	-	-	D	I	E	R	I	R	V	L	-	-	-	-	N	S	R	-	-	-	-	-	-	G	I	A	F	I	T	Y	L	N	-	E	A	N	A	Q	F	A	K	-	A	M	A	H	Q	S	-	L	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	C	L	N	V	R	W	A	T	-	T	D	P	N	P	A	S	-	-	-	Q	A	R	N	Q	R	R	L	E	E	R	A	A	N	A	V	K	K	L	L	P	K	Q	F	L	L	D	L	E	E	T	K	N	G	K
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	L	P	P	E	V	N	-	-	-	R	-	-	-	-	-	-	-	I	L	Y	I	R	-	-	N	L	P	-	Y	K	I	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	E	E	M	Y	-	-	D	I	F	G	K	Y	G	P	I	-	R	-	-	-	-	-	-	-	-	Q	I	R	V	G	N	T	P	-	-	-	-	-	-	-	E	T	R	G	T	A	Y	V	V	Y	E	D	-	I	F	D	A	K	N	A	V	D	H	L	S	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	F	N	V	S	-	-	-	N	R	Y	L	V	V	L	Y	Y	N	-	A	N	R	A	F	Q	K	M	-	D	T	K	K	K	E	E	Q	L	K	L	L	K	E	K	Y	G	I	N	T	D	P	P	K	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	-	-	-	F	-	-	-	-	-	-	-	N	L	F	V	G	-	-	D	L	N	-	V	N	V	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	E	T	L	R	-	-	N	A	F	K	D	F	-	P	-	-	-	-	-	-	-	-	S	Y	L	S	G	H	V	M	W	D	M	-	-	-	Q	T	-	G	S	S	R	G	Y	G	F	V	S	F	T	S	-	Q	D	D	A	Q	N	A	M	D	S	M	Q	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	D	L	N	-	-	-	G	R	P	L	R	I	N	W	A	A	-	-	-	-	-	-	-	-	-	-	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	A	T	T	-	-	-	-	K	-	-	-	R	-	-	-	-	-	-	-	V	L	Y	V	G	-	-	G	L	A	-	E	E	V	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	K	V	L	H	-	-	A	A	F	I	P	F	-	G	-	-	-	-	-	-	-	-	D	I	T	D	I	Q	I	P	L	D	Y	-	-	-	E	T	-	E	K	H	R	G	F	A	F	V	E	F	E	L	-	A	E	D	A	A	A	A	I	D	N	M	N	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	E	L	F	-	-	-	G	R	T	I	R	V	N	L	A	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	-	-	-	-	-	-	-	A	V	Y	V	G	-	-	S	F	S	-	W	W	T	T	D	Q	Q	L	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	I	-	-	-	-	-	-	-	V	I	R	S	I	G	V	Y	-	-	-	-	-	-	-	D	V	V	E	L	K	F	A	E	N	-	-	-	-	-	A	N	G	Q	S	K	G	Y	A	E	V	V	V	A	S	-	E	N	S	V	H	K	L	L	E	L	L	P	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	V	L	N	-	-	-	G	E	K	V	D	V	R	P	A	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	Q	N	L	S	Q	F	E	A	A	K	R	E	C	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	T	P	A	S	P	-	-	-	-	-	-	-	V	V	H	I	R	-	-	G	L	I	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	V	V	E	A	D	L	V	-	-	E	A	L	Q	E	-	F	G	-	-	-	-	-	-	-	-	P	I	S	Y	V	V	V	M	P	-	-	-	-	-	-	-	-	-	-	K	K	R	Q	A	L	V	E	F	E	D	-	V	L	G	A	C	N	A	V	N	Y	A	A	D	N	-	-	-	-	-	-	-	-	-	-	-	-	Q	I	Y	I	A	G	-	-	-	H	P	A	F	V	N	Y	S	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	Q	K	I	S	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	W	F	K	I	T	I	P	Y	-	-	-	-	-	-	-	G	R	K	-	Y	D	K	A	W	L	L	-	-	S	M	I	Q	S	K	C	S	-	-	-	-	-	-	-	V	P	F	T	P	I	E	F	H	Y	E	-	N	-	-	-	-	-	-	-	-	-	T	R	A	Q	F	F	V	E	D	-	A	S	T	A	S	A	L	K	A	V	N	Y	K	-	-	-	I	L	D	R	E	-	-	-	-	-	-	-	-	-	-	-	-	-	N	R	R	I	S	I	I	I	N	S	S	A	P	P	H	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	-	K	K	N	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	L	Y	V	G	-	-	G	I	D	-	G	A	L	N	S	K	H	L	K	P	A	Q	I	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	S	R	I	R	-	-	F	V	F	S	R	L	G	-	-	-	-	-	-	-	-	-	D	I	D	R	I	R	Y	V	-	-	-	-	E	S	K	-	-	-	-	-	-	N	C	G	F	V	K	F	K	Y	-	Q	A	N	A	E	F	A	K	E	A	M	S	N	Q	T	-	L	L	L	P	S	D	K	E	W	D	-	-	-	-	D	R	R	E	G	T	G	L	L	V	K	W	A	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	G	V	E	T	G	-	-	-	G	-	-	-	-	-	-	-	K	L	L	V	S	-	-	N	L	D	-	F	G	V	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	A	D	I	Q	-	-	E	L	F	A	E	F	-	G	-	-	-	-	-	-	-	-	T	L	K	K	A	A	V	H	Y	D	R	-	-	-	S	-	-	G	R	S	L	G	T	A	D	V	H	F	E	R	-	K	A	D	A	L	K	A	-	-	Q	Y	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	V	P	L	D	-	-	-	G	R	P	-	N	I	Q	L	V	T	-	-	-	-	-	-	-	-	-	-	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	-	-	-	P	V	L	I	I	-	-	V	E	N	-	L	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Y	P	V	T	L	D	V	L	H	-	-	Q	I	F	S	K	F	-	G	-	-	-	-	-	-	-	-	T	V	L	K	I	I	T	F	T	-	-	N	-	-	-	-	-	-	-	N	Q	F	Q	A	L	L	Q	Y	A	D	-	P	V	S	A	Q	H	A	K	L	S	L	D	G	Q	N	-	I	Y	-	-	-	N	-	-	-	-	-	-	-	-	-	-	-	A	C	C	T	L	R	I	F	S	-	K	-	L	T	S	L	N	V	Y	N	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	S	R	D	Y	T	R	P	-	-	-	-	D	L	P	S	G	D
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	P	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	V	H	I	G	-	-	R	L	T	-	R	N	V	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	H	I	M	-	-	E	I	F	S	T	Y	-	G	-	-	-	-	-	-	-	-	K	I	K	M	I	D	M	P	V	E	R	-	-	-	M	H	P	H	L	S	K	G	Y	A	Y	V	E	F	E	N	-	P	D	E	A	E	K	A	L	K	H	M	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	G	Q	I	D	-	-	-	G	Q	E	I	T	A	T	A	-	-	-	-	-	-	-	-	-	-	-	-	V	L	A	P	W	P	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	S	R	D	T	M	F	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	I	F	V	G	-	-	G	L	P	-	Y	H	T	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	K	T	L	H	-	-	E	Y	F	E	Q	F	-	G	-	-	-	-	-	-	-	-	D	I	E	E	A	V	V	I	T	D	R	-	-	-	N	T	-	Q	K	S	R	G	Y	G	F	V	T	M	K	D	-	R	A	S	A	E	R	A	C	K	-	D	P	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	P	I	I	D	-	-	-	G	R	K	A	N	V	N	L	-	-	-	-	-	-	-	-	-	-	-	-	-	A	Y	L	-	-	-	G	A	K	P	R	T	N	V	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	-	-	-	-	-	-	-	V	L	L	V	S	-	-	N	L	N	-	E	E	-	-	-	M	V	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	P	Q	S	L	F	-	-	T	L	F	G	V	Y	G	D	V	-	Q	-	-	-	-	-	-	-	-	R	V	K	I	L	-	-	-	-	-	-	-	-	-	-	-	-	-	D	S	A	L	I	Q	M	A	D	-	G	N	Q	S	Q	L	A	M	N	H	L	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	K	M	Y	-	-	-	G	K	I	I	R	V	T	L	S	K	-	H	Q	T	V	P	G	L	T	K	D	F	G	N	S	P	L	H	R	F	K	P	G	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	F	N	I	F	P	P	S	A	-	-	-	T	L	H	L	S	-	-	N	I	P	-	P	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	V	A	E	E	D	L	R	-	-	T	L	F	A	N	T	G	G	-	-	-	-	-	-	-	-	T	V	K	A	F	F	F	H	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	A	L	L	Q	M	A	T	-	V	E	E	A	I	Q	A	L	I	D	L	H	N	Y	N	-	L	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	H	H	L	V	S	F	S	K	-	S	T	I	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	-	-	-	-	-	-	-	N	I	F	I	K	-	-	N	L	D	-	K	S	I	D	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	K	A	L	Y	-	-	D	T	F	S	A	F	-	G	-	-	-	-	-	-	-	-	N	I	L	S	C	K	V	V	C	D	E	-	-	-	-	-	-	N	G	S	K	G	Y	G	F	V	H	F	E	T	-	Q	E	A	A	E	R	A	I	E	K	M	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	L	L	N	-	-	-	D	R	K	V	F	V	G	R	F	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	L	I	V	L	-	-	G	L	P	-	W	K	T	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	Q	D	L	K	-	-	E	Y	F	S	T	F	-	G	-	-	-	-	-	-	-	-	E	V	L	M	V	Q	V	K	K	D	L	-	-	-	K	T	-	G	H	S	K	G	F	G	F	V	R	F	T	E	-	Y	E	T	Q	V	K	V	M	S	-	-	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	H	M	I	D	-	-	-	G	R	W	C	D	C	K	L	-	-	-	-	-	-	-	-	-	-	-	-	-	P	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	P	E	G	-	-	-	A	-	-	-	-	-	-	-	N	L	F	I	Y	-	-	H	L	P	-	Q	E	F	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	Q	D	I	L	-	-	Q	M	F	M	P	F	-	G	-	-	-	-	-	-	-	-	N	V	I	S	A	K	V	F	I	D	-	-	-	-	-	T	-	N	L	S	K	C	F	G	F	V	S	Y	D	N	-	P	V	S	A	Q	A	A	I	Q	A	M	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	F	Q	I	G	-	-	-	M	K	R	L	K	V	Q	L	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	E	Y	K	D	N	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Y	I	Y	I	G	-	-	N	L	N	-	R	E	L	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	G	D	I	L	-	-	T	V	F	S	E	Y	-	G	-	-	-	-	-	-	-	-	V	P	V	D	V	I	L	S	R	D	E	-	-	-	N	T	-	G	E	S	Q	G	F	A	Y	L	K	Y	E	D	-	Q	R	S	T	I	L	A	V	D	N	L	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	F	K	I	G	-	-	-	G	R	A	L	K	I	D	H	-	-	-	-	-	-	-	-	-	-	-	-	T	F	Y	R	P	K	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	-	-	L	T	P	E	E	R	D	A	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	V	F	C	M	-	-	Q	L	A	-	A	-	-	-	-	-	-	-	-	-	R	I	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	P	R	D	L	E	-	-	E	F	F	S	T	V	G	-	-	-	-	-	-	-	-	-	K	V	R	D	V	R	M	I	S	D	N	-	-	-	-	-	-	-	R	S	K	G	I	A	Y	V	E	F	V	D	-	V	S	S	V	P	L	A	I	G	-	L	T	G	Q	R	-	V	L	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	V	P	I	I	V	Q	A	S	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	N	K	S	Q	P	-	-	-	K	-	-	-	-	-	-	-	R	L	H	V	S	-	-	N	I	P	-	F	R	F	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	P	D	L	R	-	-	Q	M	F	G	Q	F	-	G	-	-	-	-	-	-	-	-	K	I	L	D	V	E	I	I	F	N	-	-	-	-	E	R	-	-	G	S	K	G	F	G	F	V	T	F	E	N	-	S	A	D	A	D	R	A	R	E	K	L	H	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	V	V	E	-	-	-	G	R	K	I	E	V	N	N	A	T	-	-	-	-	-	-	-	-	-	-	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	-	-	-	-	-	-	-	T	I	L	V	K	-	-	N	L	P	-	S	D	T	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	E	E	V	L	-	-	D	Y	F	S	T	I	G	P	I	-	K	-	-	-	-	-	-	-	-	S	V	F	I	S	E	K	Q	-	-	-	A	N	-	-	-	T	P	H	K	A	F	V	T	Y	K	N	-	E	E	E	S	K	K	A	Q	K	-	L	N	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	I	F	K	-	-	-	N	H	T	I	W	V	G	P	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	A	Q	R	Q	G	A	L	A	I	M	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	V	Y	V	G	-	-	S	I	Y	-	Y	-	-	-	-	-	-	-	-	-	E	L	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	D	T	I	R	-	-	Q	A	F	A	P	F	G	-	-	-	-	-	-	-	-	-	P	I	K	S	I	D	M	S	-	-	-	-	-	-	-	-	-	-	W	H	K	G	F	A	F	V	E	Y	E	V	-	P	E	A	A	Q	L	A	L	E	-	Q	M	N	S	V	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	I	K	V	G	R	P	S	-	N	I	G	Q	A	Q	P	-	-	-	I	I	D	Q	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	L	A	E	E	A	R	A	F	-	-	-	N	-	-	-	-	-	-	-	R	I	Y	V	A	-	-	S	V	H	-	Q	D	L	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	D	D	I	S	-	-	-	V	F	E	A	F	-	-	-	-	-	-	-	-	-	-	-	G	I	S	A	T	L	A	R	D	P	-	-	-	T	T	-	G	-	H	K	G	Y	G	F	I	E	Y	E	K	-	A	Q	S	S	Q	D	A	V	S	S	M	N	L	-	-	-	-	-	-	-	-	-	-	-	-	-	-	F	D	L	-	-	-	-	G	Q	Y	L	R	V	G	A	V	T	-	-	-	-	-	-	-	-	-	-	P	P	P	L	L	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	-	-	-	N	-	-	-	-	-	-	-	T	V	Y	V	G	-	-	N	I	D	-	P	R	I	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	E	Q	L	Y	-	-	E	L	F	I	Q	I	-	N	-	-	-	-	-	-	-	-	P	V	L	R	I	K	Y	P	K	D	K	-	-	-	V	L	-	Q	A	Y	Q	G	Y	A	F	I	E	F	Y	N	-	Q	G	D	A	Q	Y	A	I	K	I	M	N	N	-	-	-	-	-	-	-	-	T	-	-	-	-	-	V	R	L	Y	-	-	-	D	R	L	I	K	V	R	Q	V	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	E	D	E	M	P	K	-	-	-	-	-	-	-	T	L	Y	V	G	-	-	N	L	S	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	V	T	E	A	L	I	L	-	-	Q	L	F	S	Q	-	I	G	-	-	-	-	-	-	-	-	P	C	K	N	C	K	M	I	M	D	-	-	-	T	-	-	A	G	-	N	D	P	Y	C	F	V	E	F	H	E	-	H	R	H	A	A	A	A	L	A	A	M	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	R	K	I	M	G	-	-	-	K	E	V	K	V	N	W	A	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	P	S	-	S	-	-	Q	K	K	D	T	S
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	Y	S	-	-	-	G	-	-	-	-	-	-	-	I	I	Y	V	S	-	-	R	L	P	-	H	G	F	H	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	K	E	L	S	-	-	K	Y	F	A	Q	F	-	G	-	-	-	-	-	-	-	-	D	L	K	E	V	R	L	A	R	N	K	-	-	-	K	T	-	G	N	S	R	H	Y	G	F	L	E	F	V	N	-	K	E	D	A	M	I	A	Q	E	S	M	N	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	Y	L	L	M	-	-	-	G	H	L	L	Q	V	R	V	L	P	-	-	-	-	-	-	-	-	-	-	K	G	A	K	I	E	K	L	Y	K	Y	K	K	R	V	L	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	A	-	S	D	E	-	-	-	G	-	-	-	-	-	-	-	K	L	F	V	G	-	-	G	L	S	-	F	D	T	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	Q	S	L	E	-	-	Q	V	F	S	K	Y	-	G	-	-	-	-	-	-	-	-	Q	I	S	E	V	V	V	V	K	D	R	-	-	-	E	T	-	Q	R	S	R	G	F	G	F	V	T	F	E	N	-	I	D	D	A	K	D	A	M	M	A	M	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	S	V	D	-	-	-	G	R	Q	I	R	V	D	Q	A	G	-	-	-	-	-	-	-	-	-	-	K	S	S	D	N	R	S	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	P	K	F	V	R	L	R	-	-	G	L	P	-	W	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	A	T	-	-	-	H	K	E	I	L	-	-	D	F	L	E	N	V	N	-	-	V	T	N	G	S	A	G	-	-	-	-	I	H	L	V	T	S	R	V	-	-	-	-	D	G	K	N	T	G	E	A	Y	V	E	V	A	S	-	Q	E	D	V	E	E	A	R	K	-	L	-	-	N	K	-	-	A	S	M	G	-	-	-	-	-	-	-	-	-	-	-	-	-	H	R	Y	I	E	V	F	T	A	T	-	-	-	-	-	-	-	-	-	-	-	P	K	E	A	K	E	A	M	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	T	A	F	V	V	K	L	R	-	-	G	L	P	-	Y	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	V	T	-	-	-	E	Q	Q	I	E	-	-	E	F	F	S	G	L	D	-	-	I	K	T	D	R	E	G	-	-	-	-	I	L	F	V	M	D	R	-	-	-	-	-	R	G	R	A	T	G	E	A	F	V	Q	F	E	S	-	Q	D	D	T	E	Q	A	L	G	-	R	-	-	N	R	-	-	E	K	I	G	-	-	-	-	-	-	-	-	-	-	-	-	-	H	R	Y	I	E	I	F	R	S	S	-	-	-	-	-	-	-	-	-	-	-	I	A	E	M	K	R	A	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	I	E	Y	Y	T	I	H	M	R	-	-	G	L	P	-	Y	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	S	F	-	-	-	E	N	D	V	F	-	-	K	F	F	E	P	-	I	-	R	P	A	-	-	-	-	-	-	-	-	N	V	R	I	N	Y	N	K	-	-	-	-	-	K	G	L	H	S	G	T	A	D	A	Y	F	D	T	-	Y	E	D	S	Q	V	A	M	K	-	-	-	-	-	R	H	R	E	Q	M	G	-	-	-	-	-	-	-	-	-	-	-	-	-	S	R	Y	I	E	L	F	Y	D	G	-	-	-	-	-	-	-	-	-	-	K	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	-	-	-	R	-	-	-	-	-	-	-	R	L	Y	V	G	-	-	N	I	P	-	F	G	I	T	E	E	A	M	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	D	F	F	N	-	-	A	Q	M	R	L	G	G	L	T	-	Q	A	P	G	-	N	P	V	L	A	V	Q	I	N	Q	-	-	-	-	-	-	-	-	-	-	-	K	N	F	A	F	L	E	F	R	S	-	V	D	E	T	T	Q	A	M	-	A	F	D	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	I	I	F	Q	-	-	-	G	Q	S	L	K	I	R	R	P	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	A	H	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	L	F	I	G	-	-	G	L	P	-	N	Y	L	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	D	D	Q	V	K	-	-	E	L	L	T	S	F	-	G	-	-	-	-	-	-	-	-	P	L	K	A	F	N	L	V	K	D	S	-	-	-	A	T	-	G	L	S	K	G	Y	A	F	C	E	Y	V	D	-	I	N	V	T	D	Q	A	I	A	G	L	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	M	Q	L	G	-	-	-	D	K	K	L	L	V	Q	R	-	-	-	-	-	-	-	-	-	-	-	-	-	A	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	-	-	-	-	-	-	-	S	I	F	I	K	-	-	N	L	P	-	T	I	T	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	D	D	I	L	-	-	N	F	F	S	E	V	G	-	-	-	-	-	-	-	-	-	P	I	K	S	I	Y	L	S	N	-	-	-	-	-	-	-	-	-	-	-	A	L	W	A	F	V	T	Y	K	N	-	S	S	D	S	E	K	A	I	K	R	Y	N	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	F	Y	F	R	-	-	-	G	K	K	L	L	V	T	R	A	Q	-	D	K	E	E	R	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	L	P	N	-	-	-	Q	-	-	-	-	-	-	-	T	I	Y	I	N	-	-	N	L	N	-	E	K	I	K	K	E	E	L	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	K	K	S	L	Y	-	-	A	I	F	S	Q	F	G	Q	I	-	L	-	-	-	-	-	-	-	-	D	I	V	A	L	K	T	L	-	-	-	-	-	-	-	K	M	R	G	Q	A	F	V	I	F	K	E	-	I	G	S	A	S	N	A	L	R	T	M	Q	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	F	P	F	Y	-	-	-	D	K	P	M	Q	I	A	Y	S	K	-	S	-	-	-	-	-	-	-	-	-	D	S	D	I	V	A	K	I	K	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	M	A	G	L	T	V	R	D	P	A	V	D	R	S	L	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	S	V	F	V	G	-	-	N	I	P	-	Y	E	A	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	E	Q	L	K	-	-	D	I	F	S	E	V	-	G	-	-	-	-	-	-	-	-	P	V	V	S	F	R	L	V	Y	D	R	-	-	-	E	T	-	G	K	P	K	G	Y	G	F	C	E	Y	Q	D	-	Q	E	T	A	L	S	A	M	R	N	L	N	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	R	E	F	S	-	-	-	G	R	A	L	R	V	D	N	-	-	-	-	-	-	-	-	-	-	-	-	-	A	A	S	E	K	N	K	E	E	L	K	S	L	G	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	P	-	-	-	M	-	-	-	-	-	-	-	R	L	Y	V	G	-	-	S	L	H	-	F	N	I	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	D	M	L	R	-	-	G	I	F	E	P	F	-	G	-	-	-	-	-	-	-	-	R	I	E	S	I	Q	L	M	M	D	S	-	-	-	-	T	-	G	R	S	K	G	Y	G	F	I	T	F	S	D	-	S	E	C	A	K	K	A	L	-	Q	L	N	G	-	-	-	-	-	-	-	-	-	-	-	-	-	-	F	E	L	A	-	-	-	G	R	P	M	K	V	G	H	V	T	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	N	A	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	T	I	R	V	T	-	-	N	L	S	-	E	D	T	R	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	E	T	D	L	Q	-	-	E	L	F	R	P	F	-	G	-	-	-	-	-	-	-	-	S	I	S	R	I	Y	L	A	K	D	K	-	-	-	T	T	-	G	Q	S	K	G	F	A	F	I	S	F	H	R	-	R	E	D	A	A	R	A	I	A	G	V	S	-	-	-	-	-	-	-	-	-	-	-	-	-	-	G	F	G	Y	D	-	-	-	H	L	I	L	N	V	E	W	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-

Member	Chain	UniProtKB	GO term
d1cvja1	A	P11940	GO:0003676
d1cvja1	A	P11940	GO:0003723
d1fxla1	A	P26378	GO:0003676
d1fxla1	A	P26378	GO:0003723
d1fxla1	A	P26378	GO:1990904
d1fxla1	A	P26378	GO:0003676
d1fxla1	A	P26378	GO:0003723
d1fxla1	A	P26378	GO:1990904
d1fxla2	A	P26378	GO:0003676
d1fxla2	A	P26378	GO:0003723
d1fxla2	A	P26378	GO:1990904
d1fxla2	A	P26378	GO:0003676
d1fxla2	A	P26378	GO:0003723
d1fxla2	A	P26378	GO:1990904
d1jmta_	A	Q01081	GO:0000398
d1jmta_	A	Q01081	GO:0003676
d1jmta_	A	Q01081	GO:0003723
d1jmta_	A	Q01081	GO:0089701
d1jmta_	A	P26368	GO:0000398
d1jmta_	A	P26368	GO:0003676
d1jmta_	A	P26368	GO:0003723
d1jmta_	A	P26368	GO:0089701
d1l3ka1	A	P09651	GO:0003676
d1l3ka1	A	P09651	GO:0003723
d1l3ka1	A	P09651	GO:0003676
d1l3ka1	A	P09651	GO:0003723
d1l3ka2	A	P09651	GO:0003676
d1l3ka2	A	P09651	GO:0003723
d1l3ka2	A	P09651	GO:0003676
d1l3ka2	A	P09651	GO:0003723
d1oo0b_	B	P49028	GO:0003723
d1oo0b_	B	P49028	GO:0005634
d1oo0b_	B	P49028	GO:0005737
d1oo0b_	B	P49028	GO:0003676
d1oo0b_	B	P49028	GO:0003729
d1oo0b_	B	P49028	GO:0006396
d1oo0b_	B	Q9V535	GO:0003723
d1oo0b_	B	Q9V535	GO:0005634
d1oo0b_	B	Q9V535	GO:0005737
d1oo0b_	B	Q9V535	GO:0003676
d1oo0b_	B	Q9V535	GO:0003729
d1oo0b_	B	Q9V535	GO:0006396
d1uw4a_	A	Q9BZI7	GO:0000184
d1uw4a_	A	Q9BZI7	GO:0003676
d1uw4a_	A	Q9HAU5	GO:0000184
d1uw4a_	A	Q9HAU5	GO:0003676
d1wela1	A	Q9NTZ6	GO:0003676
d1wela1	A	Q9NTZ6	GO:0003723
d1wwha1	A	Q8R4R6	GO:0003676
d1wwha1	A	Q8R4R6	GO:0006913
d1wwha1	A	Q8R4R6	GO:0017056
d1wwha1	A	Q8R4R6	GO:0031965
d1x4da1	A	Q8K310	GO:0003676
d1x4da1	A	Q8K310	GO:0003723
d1x4fa1	A	Q8K310	GO:0003676
d1x4fa1	A	Q8K310	GO:0003723
d1x4ha1	A	Q8CGC6	GO:0003676
d1x4ha1	A	Q8CGC6	GO:0003723
d1x5oa1	A	P29558	GO:0003676
d1x5oa1	A	P29558	GO:0003723
d1x5oa1	A	P29558	GO:1990904
d1zh5a2	A	P05455	GO:0003676
d1zh5a2	A	P05455	GO:0003723
d1zh5a2	A	P05455	GO:0005634
d1zh5a2	A	P05455	GO:0006396
d1zh5a2	A	P05455	GO:1990904
d2b0ga1	A	P43332	GO:0003676
d2b0ga1	A	P43332	GO:0003723
d2bz2a1	A	P18615	GO:0003676
d2bz2a1	A	P18615	GO:0003723
d2bz2a1	A	P18615	GO:0006355
d2bz2a1	A	P18615	GO:0032021
d2cpda1	A	Q9NQ94	GO:0003676
d2cpda1	A	Q9NQ94	GO:0003723
d2cpfa1	A	Q8R3C6	GO:0003676
d2cpfa1	A	Q8R3C6	GO:0003723
d2cpia1	A	Q8BT14	GO:0003676
d2cpia1	A	Q8BT14	GO:0003723
d2cpia1	A	Q8BT14	GO:0004842
d2cpia1	A	Q8BT14	GO:0030014
d2cpxa1	A	Q96IZ5	GO:0003676
d2cpxa1	A	Q96IZ5	GO:0003723
d2cpya1	A	Q9NTZ6	GO:0003676
d2cpya1	A	Q9NTZ6	GO:0003723
d2cq1a1	A	Q9UKA9	GO:0003676
d2cq1a1	A	Q9UKA9	GO:0003723
d2cq2a1	A	Q96BT7	GO:0003676
d2cq2a1	A	Q96BT7	GO:0003723
d2cqha1	A	Q9Y6M1	GO:0003676
d2cqha1	A	Q9Y6M1	GO:0003723
d2dgxa1	A	Q9Y4F3	GO:0003676
d2dgxa1	A	Q9Y4F3	GO:0003723
d2disa1	A	A0AV96	GO:0003676
d2disa1	A	A0AV96	GO:0003723
d2dita1	A	O43719	GO:0003676
d2dita1	A	O43719	GO:0003723
d2ghpa1	A	P49960	GO:0003676
d2ghpa1	A	P49960	GO:0003723
d2ghpa1	A	P49960	GO:0003676
d2ghpa1	A	P49960	GO:0003723
d2ghpa1	A	P49960	GO:0003676
d2ghpa1	A	P49960	GO:0003723
d2ghpa2	A	P49960	GO:0003676
d2ghpa2	A	P49960	GO:0003723
d2ghpa2	A	P49960	GO:0003676
d2ghpa2	A	P49960	GO:0003723
d2ghpa2	A	P49960	GO:0003676
d2ghpa2	A	P49960	GO:0003723
d2ghpa3	A	P49960	GO:0003676
d2ghpa3	A	P49960	GO:0003723
d2ghpa3	A	P49960	GO:0003676
d2ghpa3	A	P49960	GO:0003723
d2ghpa3	A	P49960	GO:0003676
d2ghpa3	A	P49960	GO:0003723