PASS2.8 - Home

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x

beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x

hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x

                             10        20        30        40        50  
d1wiba1  (   2 )    ppkfdpnev-kvvylrctGGevgatsalapkigplglspkkvgddiakat
d3cjsb1  (   1 )         mkkvvavvklqLpAgkAtpappVgpaLgqhgAnimeFVkaFnaaT
                              bbbbbbbb                    aaaaaaaaaaa 

                             60        70        80     
d1wiba1  (  51 )    gdwkglritvkltiqn-rqaqievvpsasalsgpss
d3cjsb1  (  46 )    anmgdaiVpVeItIyadrsftfvtk           
                          bbbbbbbbb    bbbbb

Domains
Outliers

Domain ID	Name	Family	Source	Domain	STRING-DB
d1wiba1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1wiba1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	60S ribosomal protein L12	Ribosomal L11/L12e N-terminal domain	Mouse (Mus musculus) [TaxId: 10090]		view
d3cjsb1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3cjsb1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Ribosomal protein L11, N-terminal domain	Ribosomal L11/L12e N-terminal domain	Thermus thermophilus [TaxId: 274]		view

No outliers

Feature	Download
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

									10										20										30										40										50										60										70										80
P	P	K	F	D	P	N	E	V	-	K	V	V	Y	L	R	C	T	G	G	E	V	G	A	T	S	A	L	A	P	K	I	G	P	L	G	L	S	P	K	K	V	G	D	D	I	A	K	A	T	G	D	W	K	G	L	R	I	T	V	K	L	T	I	Q	N	-	R	Q	A	Q	I	E	V	V	P	S	A	S	A	L	S	G	P	S	S
-	-	-	-	-	M	K	K	V	V	A	V	V	K	L	Q	L	P	A	G	K	A	T	P	A	P	P	V	G	P	A	L	G	Q	H	G	A	N	I	M	E	F	V	K	A	F	N	A	A	T	A	N	M	G	D	A	I	V	P	V	E	I	T	I	Y	A	D	R	S	F	T	F	V	T	K	-	-	-	-	-	-	-	-	-	-	-

Member	Chain	UniProtKB	GO term
d3cjsb1	B	Q84BQ9	GO:0003735
d3cjsb1	B	Q84BQ9	GO:0005840
d3cjsb1	B	Q84BQ9	GO:0006412
d3cjsb1	B	P36238	GO:0003735
d3cjsb1	B	P36238	GO:0005840
d3cjsb1	B	P36238	GO:0006412

									10										20										30										40										50										60										70										80
P	P	K	F	D	P	N	E	V	-	K	V	V	Y	L	R	C	T	G	G	E	V	G	A	T	S	A	L	A	P	K	I	G	P	L	G	L	S	P	K	K	V	G	D	D	I	A	K	A	T	G	D	W	K	G	L	R	I	T	V	K	L	T	I	Q	N	-	R	Q	A	Q	I	E	V	V	P	S	A	S	A	L	S	G	P	S	S
-	-	-	-	-	M	K	K	V	V	A	V	V	K	L	Q	L	P	A	G	K	A	T	P	A	P	P	V	G	P	A	L	G	Q	H	G	A	N	I	M	E	F	V	K	A	F	N	A	A	T	A	N	M	G	D	A	I	V	P	V	E	I	T	I	Y	A	D	R	S	F	T	F	V	T	K	-	-	-	-	-	-	-	-	-	-	-

									10										20										30										40										50										60										70										80
P	P	K	F	D	P	N	E	V	-	K	V	V	Y	L	R	C	T	G	G	E	V	G	A	T	S	A	L	A	P	K	I	G	P	L	G	L	S	P	K	K	V	G	D	D	I	A	K	A	T	G	D	W	K	G	L	R	I	T	V	K	L	T	I	Q	N	-	R	Q	A	Q	I	E	V	V	P	S	A	S	A	L	S	G	P	S	S
-	-	-	-	-	M	K	K	V	V	A	V	V	K	L	Q	L	P	A	G	K	A	T	P	A	P	P	V	G	P	A	L	G	Q	H	G	A	N	I	M	E	F	V	K	A	F	N	A	A	T	A	N	M	G	D	A	I	V	P	V	E	I	T	I	Y	A	D	R	S	F	T	F	V	T	K	-	-	-	-	-	-	-	-	-	-	-

									10										20										30										40										50										60										70										80
P	P	K	F	D	P	N	E	V	-	K	V	V	Y	L	R	C	T	G	G	E	V	G	A	T	S	A	L	A	P	K	I	G	P	L	G	L	S	P	K	K	V	G	D	D	I	A	K	A	T	G	D	W	K	G	L	R	I	T	V	K	L	T	I	Q	N	-	R	Q	A	Q	I	E	V	V	P	S	A	S	A	L	S	G	P	S	S
-	-	-	-	-	M	K	K	V	V	A	V	V	K	L	Q	L	P	A	G	K	A	T	P	A	P	P	V	G	P	A	L	G	Q	H	G	A	N	I	M	E	F	V	K	A	F	N	A	A	T	A	N	M	G	D	A	I	V	P	V	E	I	T	I	Y	A	D	R	S	F	T	F	V	T	K	-	-	-	-	-	-	-	-	-	-	-