PASS2.8 - Home

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x

beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x

hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x

                             10        20        30        40       
d1e0na-  (   7 )                 pgweiihen--grplyyNaeqktklhypp      
d1eg3a3  (  47 )    pasqhflstsvq-gpweraisp-nkvpyyinhetqttcwd        
d1o6wa2  (  30 )    kelisqeelllrengwkaakta-dgkvyyynpttretswtip-afekk
d1ywia1  (  15 )                 smwtehkSp-dgrtyyyntetkqstwekp      
d2ho2a1  ( 253 )             sdLpagwmrvqdt-s-gtyywhiptgttqwepPgr    
d2itka1  (   7 )               lppGwekamsrssgrvyyfNhitnasqwerPs     
d4n7fa1  ( 422 )              flpkgwevrhap-ngrpfFidhntktttwedprl    
d4rexa1  ( 165 )       feipddvplpagwemakts-sgqryFlnhidqtttwqdpRkamls
                                   bbbbb      bbbbb    bbb

Domains
Outliers

Domain ID	Name	Family	Source	STRING-DB
d1e0na- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1e0na- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Hypothetical protein Yjq8 (Set2p)	WW domain	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]	view
d1eg3a3 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1eg3a3 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Dystrophin	WW domain	Human (Homo sapiens) [TaxId: 9606]	view
d1o6wa2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1o6wa2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Splicing factor prp40	WW domain	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]	view
d1ywia1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1ywia1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Huntingtin-interacting protein HYPA/FBP11	WW domain	Human (Homo sapiens) [TaxId: 9606]	view
d2ho2a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2ho2a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Amyloid beta A4 precursor protein-binding family B member 1, APBB1	WW domain	Human (Homo sapiens) [TaxId: 9606]	view
d2itka1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2itka1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Mitotic rotamase PIN1	WW domain	Human (Homo sapiens) [TaxId: 9606]	view
d4n7fa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4n7fa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Human (Homo sapiens) [TaxId: 9606]	view
d4rexa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d4rexa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	WW domain	Human (Homo sapiens) [TaxId: 9606]	view

Domain ID	Name
d2dk1a1	2dk1 A:8-44

Feature	Download
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

									10										20										30										40
-	-	-	-	-	-	-	-	-	-	-	-	-	P	G	W	E	I	I	H	E	N	-	-	G	R	P	L	Y	Y	N	A	E	Q	K	T	K	L	H	Y	P	P	-	-	-	-	-	-
P	A	S	Q	H	F	L	S	T	S	V	Q	-	G	P	W	E	R	A	I	S	P	-	N	K	V	P	Y	Y	I	N	H	E	T	Q	T	T	C	W	D	-	-	-	-	-	-	-	-
K	E	L	I	S	Q	E	E	L	L	L	R	E	N	G	W	K	A	A	K	T	A	-	D	G	K	V	Y	Y	Y	N	P	T	T	R	E	T	S	W	T	I	P	-	A	F	E	K	K
-	-	-	-	-	-	-	-	-	-	-	-	-	S	M	W	T	E	H	K	S	P	-	D	G	R	T	Y	Y	Y	N	T	E	T	K	Q	S	T	W	E	K	P	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	S	D	L	P	A	G	W	M	R	V	Q	D	T	-	S	-	G	T	Y	Y	W	H	I	P	T	G	T	T	Q	W	E	P	P	G	R	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	L	P	P	G	W	E	K	A	M	S	R	S	S	G	R	V	Y	Y	F	N	H	I	T	N	A	S	Q	W	E	R	P	S	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	F	L	P	K	G	W	E	V	R	H	A	P	-	N	G	R	P	F	F	I	D	H	N	T	K	T	T	T	W	E	D	P	R	L	-	-	-	-
-	-	-	F	E	I	P	D	D	V	P	L	P	A	G	W	E	M	A	K	T	S	-	S	G	Q	R	Y	F	L	N	H	I	D	Q	T	T	T	W	Q	D	P	R	K	A	M	L	S

Member	Chain	UniProtKB	GO term
d1o6wa2	A	P33203	GO:0045292
d1ywia1	A	O75400	GO:0045292
d2ho2a1	A	O00213	GO:0001540
d2ho2a1	A	Q8N8S7	GO:0001540
d2itka1	A	Q13526	GO:0000413
d2itka1	A	Q13526	GO:0001666
d2itka1	A	Q13526	GO:0001932
d2itka1	A	Q13526	GO:0001934
d2itka1	A	Q13526	GO:0003755
d2itka1	A	Q13526	GO:0003774
d2itka1	A	Q13526	GO:0005515
d2itka1	A	Q13526	GO:0005634
d2itka1	A	Q13526	GO:0005654
d2itka1	A	Q13526	GO:0005737
d2itka1	A	Q13526	GO:0005829
d2itka1	A	Q13526	GO:0007088
d2itka1	A	Q13526	GO:0008013
d2itka1	A	Q13526	GO:0010468
d2itka1	A	Q13526	GO:0016607
d2itka1	A	Q13526	GO:0016859
d2itka1	A	Q13526	GO:0030182
d2itka1	A	Q13526	GO:0030496
d2itka1	A	Q13526	GO:0030512
d2itka1	A	Q13526	GO:0031434
d2itka1	A	Q13526	GO:0031647
d2itka1	A	Q13526	GO:0032091
d2itka1	A	Q13526	GO:0032092
d2itka1	A	Q13526	GO:0032465
d2itka1	A	Q13526	GO:0032794
d2itka1	A	Q13526	GO:0035307
d2itka1	A	Q13526	GO:0036064
d2itka1	A	Q13526	GO:0042177
d2itka1	A	Q13526	GO:0043547
d2itka1	A	Q13526	GO:0045944
d2itka1	A	Q13526	GO:0046785
d2itka1	A	Q13526	GO:0048156
d2itka1	A	Q13526	GO:0050808
d2itka1	A	Q13526	GO:0050815
d2itka1	A	Q13526	GO:0050816
d2itka1	A	Q13526	GO:0050821
d2itka1	A	Q13526	GO:0051219
d2itka1	A	Q13526	GO:0060255
d2itka1	A	Q13526	GO:0060392
d2itka1	A	Q13526	GO:0070373
d2itka1	A	Q13526	GO:0080090
d2itka1	A	Q13526	GO:0090263
d2itka1	A	Q13526	GO:0098978
d2itka1	A	Q13526	GO:0099524
d2itka1	A	Q13526	GO:1900180
d2itka1	A	Q13526	GO:1902430
d2itka1	A	Q13526	GO:1990757
d2itka1	A	Q13526	GO:2000146
d2itka1	A	Q13526	GO:0000413
d2itka1	A	Q13526	GO:0001666
d2itka1	A	Q13526	GO:0001932
d2itka1	A	Q13526	GO:0001934
d2itka1	A	Q13526	GO:0003755
d2itka1	A	Q13526	GO:0003774
d2itka1	A	Q13526	GO:0005515
d2itka1	A	Q13526	GO:0005634
d2itka1	A	Q13526	GO:0005654
d2itka1	A	Q13526	GO:0005737
d2itka1	A	Q13526	GO:0005829
d2itka1	A	Q13526	GO:0007088
d2itka1	A	Q13526	GO:0008013
d2itka1	A	Q13526	GO:0010468
d2itka1	A	Q13526	GO:0016607
d2itka1	A	Q13526	GO:0016859
d2itka1	A	Q13526	GO:0030182
d2itka1	A	Q13526	GO:0030496
d2itka1	A	Q13526	GO:0030512
d2itka1	A	Q13526	GO:0031434
d2itka1	A	Q13526	GO:0031647
d2itka1	A	Q13526	GO:0032091
d2itka1	A	Q13526	GO:0032092
d2itka1	A	Q13526	GO:0032465
d2itka1	A	Q13526	GO:0032794
d2itka1	A	Q13526	GO:0035307
d2itka1	A	Q13526	GO:0036064
d2itka1	A	Q13526	GO:0042177
d2itka1	A	Q13526	GO:0043547
d2itka1	A	Q13526	GO:0045944
d2itka1	A	Q13526	GO:0046785
d2itka1	A	Q13526	GO:0048156
d2itka1	A	Q13526	GO:0050808
d2itka1	A	Q13526	GO:0050815
d2itka1	A	Q13526	GO:0050816
d2itka1	A	Q13526	GO:0050821
d2itka1	A	Q13526	GO:0051219
d2itka1	A	Q13526	GO:0060255
d2itka1	A	Q13526	GO:0060392
d2itka1	A	Q13526	GO:0070373
d2itka1	A	Q13526	GO:0080090
d2itka1	A	Q13526	GO:0090263
d2itka1	A	Q13526	GO:0098978
d2itka1	A	Q13526	GO:0099524
d2itka1	A	Q13526	GO:1900180
d2itka1	A	Q13526	GO:1902430
d2itka1	A	Q13526	GO:1990757
d2itka1	A	Q13526	GO:2000146
d2itka1	A	Q13526	GO:0000413
d2itka1	A	Q13526	GO:0001666
d2itka1	A	Q13526	GO:0001932
d2itka1	A	Q13526	GO:0001934
d2itka1	A	Q13526	GO:0003755
d2itka1	A	Q13526	GO:0003774
d2itka1	A	Q13526	GO:0005515
d2itka1	A	Q13526	GO:0005634
d2itka1	A	Q13526	GO:0005654
d2itka1	A	Q13526	GO:0005737
d2itka1	A	Q13526	GO:0005829
d2itka1	A	Q13526	GO:0007088
d2itka1	A	Q13526	GO:0008013
d2itka1	A	Q13526	GO:0010468
d2itka1	A	Q13526	GO:0016607
d2itka1	A	Q13526	GO:0016859
d2itka1	A	Q13526	GO:0030182
d2itka1	A	Q13526	GO:0030496
d2itka1	A	Q13526	GO:0030512
d2itka1	A	Q13526	GO:0031434
d2itka1	A	Q13526	GO:0031647
d2itka1	A	Q13526	GO:0032091
d2itka1	A	Q13526	GO:0032092
d2itka1	A	Q13526	GO:0032465
d2itka1	A	Q13526	GO:0032794
d2itka1	A	Q13526	GO:0035307
d2itka1	A	Q13526	GO:0036064
d2itka1	A	Q13526	GO:0042177
d2itka1	A	Q13526	GO:0043547
d2itka1	A	Q13526	GO:0045944
d2itka1	A	Q13526	GO:0046785
d2itka1	A	Q13526	GO:0048156
d2itka1	A	Q13526	GO:0050808
d2itka1	A	Q13526	GO:0050815
d2itka1	A	Q13526	GO:0050816
d2itka1	A	Q13526	GO:0050821
d2itka1	A	Q13526	GO:0051219
d2itka1	A	Q13526	GO:0060255
d2itka1	A	Q13526	GO:0060392
d2itka1	A	Q13526	GO:0070373
d2itka1	A	Q13526	GO:0080090
d2itka1	A	Q13526	GO:0090263
d2itka1	A	Q13526	GO:0098978
d2itka1	A	Q13526	GO:0099524
d2itka1	A	Q13526	GO:1900180
d2itka1	A	Q13526	GO:1902430
d2itka1	A	Q13526	GO:1990757
d2itka1	A	Q13526	GO:2000146

									10										20										30										40
-	-	-	-	-	-	-	-	-	-	-	-	-	P	G	W	E	I	I	H	E	N	-	-	G	R	P	L	Y	Y	N	A	E	Q	K	T	K	L	H	Y	P	P	-	-	-	-	-	-
P	A	S	Q	H	F	L	S	T	S	V	Q	-	G	P	W	E	R	A	I	S	P	-	N	K	V	P	Y	Y	I	N	H	E	T	Q	T	T	C	W	D	-	-	-	-	-	-	-	-
K	E	L	I	S	Q	E	E	L	L	L	R	E	N	G	W	K	A	A	K	T	A	-	D	G	K	V	Y	Y	Y	N	P	T	T	R	E	T	S	W	T	I	P	-	A	F	E	K	K
-	-	-	-	-	-	-	-	-	-	-	-	-	S	M	W	T	E	H	K	S	P	-	D	G	R	T	Y	Y	Y	N	T	E	T	K	Q	S	T	W	E	K	P	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	S	D	L	P	A	G	W	M	R	V	Q	D	T	-	S	-	G	T	Y	Y	W	H	I	P	T	G	T	T	Q	W	E	P	P	G	R	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	L	P	P	G	W	E	K	A	M	S	R	S	S	G	R	V	Y	Y	F	N	H	I	T	N	A	S	Q	W	E	R	P	S	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	F	L	P	K	G	W	E	V	R	H	A	P	-	N	G	R	P	F	F	I	D	H	N	T	K	T	T	T	W	E	D	P	R	L	-	-	-	-
-	-	-	F	E	I	P	D	D	V	P	L	P	A	G	W	E	M	A	K	T	S	-	S	G	Q	R	Y	F	L	N	H	I	D	Q	T	T	T	W	Q	D	P	R	K	A	M	L	S

									10										20										30										40
-	-	-	-	-	-	-	-	-	-	-	-	-	P	G	W	E	I	I	H	E	N	-	-	G	R	P	L	Y	Y	N	A	E	Q	K	T	K	L	H	Y	P	P	-	-	-	-	-	-
P	A	S	Q	H	F	L	S	T	S	V	Q	-	G	P	W	E	R	A	I	S	P	-	N	K	V	P	Y	Y	I	N	H	E	T	Q	T	T	C	W	D	-	-	-	-	-	-	-	-
K	E	L	I	S	Q	E	E	L	L	L	R	E	N	G	W	K	A	A	K	T	A	-	D	G	K	V	Y	Y	Y	N	P	T	T	R	E	T	S	W	T	I	P	-	A	F	E	K	K
-	-	-	-	-	-	-	-	-	-	-	-	-	S	M	W	T	E	H	K	S	P	-	D	G	R	T	Y	Y	Y	N	T	E	T	K	Q	S	T	W	E	K	P	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	S	D	L	P	A	G	W	M	R	V	Q	D	T	-	S	-	G	T	Y	Y	W	H	I	P	T	G	T	T	Q	W	E	P	P	G	R	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	L	P	P	G	W	E	K	A	M	S	R	S	S	G	R	V	Y	Y	F	N	H	I	T	N	A	S	Q	W	E	R	P	S	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	F	L	P	K	G	W	E	V	R	H	A	P	-	N	G	R	P	F	F	I	D	H	N	T	K	T	T	T	W	E	D	P	R	L	-	-	-	-
-	-	-	F	E	I	P	D	D	V	P	L	P	A	G	W	E	M	A	K	T	S	-	S	G	Q	R	Y	F	L	N	H	I	D	Q	T	T	T	W	Q	D	P	R	K	A	M	L	S

									10										20										30										40
-	-	-	-	-	-	-	-	-	-	-	-	-	P	G	W	E	I	I	H	E	N	-	-	G	R	P	L	Y	Y	N	A	E	Q	K	T	K	L	H	Y	P	P	-	-	-	-	-	-
P	A	S	Q	H	F	L	S	T	S	V	Q	-	G	P	W	E	R	A	I	S	P	-	N	K	V	P	Y	Y	I	N	H	E	T	Q	T	T	C	W	D	-	-	-	-	-	-	-	-
K	E	L	I	S	Q	E	E	L	L	L	R	E	N	G	W	K	A	A	K	T	A	-	D	G	K	V	Y	Y	Y	N	P	T	T	R	E	T	S	W	T	I	P	-	A	F	E	K	K
-	-	-	-	-	-	-	-	-	-	-	-	-	S	M	W	T	E	H	K	S	P	-	D	G	R	T	Y	Y	Y	N	T	E	T	K	Q	S	T	W	E	K	P	-	-	-	-	-	-
-	-	-	-	-	-	-	-	-	S	D	L	P	A	G	W	M	R	V	Q	D	T	-	S	-	G	T	Y	Y	W	H	I	P	T	G	T	T	Q	W	E	P	P	G	R	-	-	-	-
-	-	-	-	-	-	-	-	-	-	-	L	P	P	G	W	E	K	A	M	S	R	S	S	G	R	V	Y	Y	F	N	H	I	T	N	A	S	Q	W	E	R	P	S	-	-	-	-	-
-	-	-	-	-	-	-	-	-	-	F	L	P	K	G	W	E	V	R	H	A	P	-	N	G	R	P	F	F	I	D	H	N	T	K	T	T	T	W	E	D	P	R	L	-	-	-	-
-	-	-	F	E	I	P	D	D	V	P	L	P	A	G	W	E	M	A	K	T	S	-	S	G	Q	R	Y	F	L	N	H	I	D	Q	T	T	T	W	Q	D	P	R	K	A	M	L	S