PASS2.8 - Home

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x

beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x

hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x

                             10        20        30        40        50  
d1tbge-  ( 501 )    adltekdkl-mevdqlkkevtlermlvskcceefrdyveersgedplvkg
d3v5wg-  (   8 )        siaqarklveqlkmeanidrikvskaaadlmayceahakedplltp
                               aaaaaaaaa      aaaaaaaaaaaaa           

                             60  
d1tbge-  ( 557 )    ipedknpfk  
d3v5wg-  (  54 )    vpasenpfrek
                      333

Domains
Outliers

Domain ID	Name	Family	Source	Domain	STRING-DB
d1tbge- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1tbge- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Transducin (heterotrimeric G protein), gamma chain	Transducin (heterotrimeric G protein), gamma chain	Cow (Bos taurus) [TaxId: 9913]		view
d3v5wg- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3v5wg- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Transducin (heterotrimeric G protein), gamma chain	Transducin (heterotrimeric G protein), gamma chain	Cow (Bos taurus) [TaxId: 9913]		view

No outliers

Feature	Download
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

									10										20										30										40										50										60
A	D	L	T	E	K	D	K	L	-	M	E	V	D	Q	L	K	K	E	V	T	L	E	R	M	L	V	S	K	C	C	E	E	F	R	D	Y	V	E	E	R	S	G	E	D	P	L	V	K	G	I	P	E	D	K	N	P	F	K	-	-
-	-	-	-	S	I	A	Q	A	R	K	L	V	E	Q	L	K	M	E	A	N	I	D	R	I	K	V	S	K	A	A	A	D	L	M	A	Y	C	E	A	H	A	K	E	D	P	L	L	T	P	V	P	A	S	E	N	P	F	R	E	K

Member	Chain	UniProtKB	GO term
d1tbge_	E	P62871	GO:0005834
d1tbge_	E	P62871	GO:0007165
d1tbge_	E	P62871	GO:0007186
d1tbge_	E	P62871	GO:0097381
d1tbge_	E	P62871	GO:0005886
d1tbge_	E	P62871	GO:0031681
d1tbge_	E	P02698	GO:0005834
d1tbge_	E	P02698	GO:0007165
d1tbge_	E	P02698	GO:0007186
d1tbge_	E	P02698	GO:0097381
d1tbge_	E	P02698	GO:0005886
d1tbge_	E	P02698	GO:0031681
d1tbge_	E	P62871	GO:0005834
d1tbge_	E	P62871	GO:0007165
d1tbge_	E	P62871	GO:0007186
d1tbge_	E	P62871	GO:0097381
d1tbge_	E	P62871	GO:0005886
d1tbge_	E	P62871	GO:0031681
d1tbge_	E	P02698	GO:0005834
d1tbge_	E	P02698	GO:0007165
d1tbge_	E	P02698	GO:0007186
d1tbge_	E	P02698	GO:0097381
d1tbge_	E	P02698	GO:0005886
d1tbge_	E	P02698	GO:0031681

									10										20										30										40										50										60
A	D	L	T	E	K	D	K	L	-	M	E	V	D	Q	L	K	K	E	V	T	L	E	R	M	L	V	S	K	C	C	E	E	F	R	D	Y	V	E	E	R	S	G	E	D	P	L	V	K	G	I	P	E	D	K	N	P	F	K	-	-
-	-	-	-	S	I	A	Q	A	R	K	L	V	E	Q	L	K	M	E	A	N	I	D	R	I	K	V	S	K	A	A	A	D	L	M	A	Y	C	E	A	H	A	K	E	D	P	L	L	T	P	V	P	A	S	E	N	P	F	R	E	K

									10										20										30										40										50										60
A	D	L	T	E	K	D	K	L	-	M	E	V	D	Q	L	K	K	E	V	T	L	E	R	M	L	V	S	K	C	C	E	E	F	R	D	Y	V	E	E	R	S	G	E	D	P	L	V	K	G	I	P	E	D	K	N	P	F	K	-	-
-	-	-	-	S	I	A	Q	A	R	K	L	V	E	Q	L	K	M	E	A	N	I	D	R	I	K	V	S	K	A	A	A	D	L	M	A	Y	C	E	A	H	A	K	E	D	P	L	L	T	P	V	P	A	S	E	N	P	F	R	E	K

									10										20										30										40										50										60
A	D	L	T	E	K	D	K	L	-	M	E	V	D	Q	L	K	K	E	V	T	L	E	R	M	L	V	S	K	C	C	E	E	F	R	D	Y	V	E	E	R	S	G	E	D	P	L	V	K	G	I	P	E	D	K	N	P	F	K	-	-
-	-	-	-	S	I	A	Q	A	R	K	L	V	E	Q	L	K	M	E	A	N	I	D	R	I	K	V	S	K	A	A	A	D	L	M	A	Y	C	E	A	H	A	K	E	D	P	L	L	T	P	V	P	A	S	E	N	P	F	R	E	K