PASS2.8 - Home

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x

beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x

hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x

                             10        20        30      
d1b0na1  (  74 )      ldseweklvrdamtsgvskkqfrefldyqkwrksq
d1b0nb-  (   9 )    feldqewvelmveakeanispeeirkyllln      
                        aaaaaaaaaaaa    aaaaaaaaaa

Domains
Outliers

Domain ID	Name	Family	Source	Domain	STRING-DB
d1b0na1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1b0na1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	SinR repressor dimerisation domain	SinR repressor dimerisation domain-like	Bacillus subtilis [TaxId: 1423]		view
d1b0nb- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1b0nb- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	SinI anti-repressor	SinR repressor dimerisation domain-like	Bacillus subtilis [TaxId: 1423]		view

No outliers

Feature	Download
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

									10										20										30
-	-	L	D	S	E	W	E	K	L	V	R	D	A	M	T	S	G	V	S	K	K	Q	F	R	E	F	L	D	Y	Q	K	W	R	K	S	Q
F	E	L	D	Q	E	W	V	E	L	M	V	E	A	K	E	A	N	I	S	P	E	E	I	R	K	Y	L	L	L	N	-	-	-	-	-	-

Member	Chain	UniProtKB	GO term
d1b0na1	A	P06533	GO:0003677
d1b0na1	A	P06533	GO:0003700
d1b0na1	A	P06533	GO:0006355
d1b0na1	A	P06533	GO:0010629
d1b0na1	A	P06533	GO:0030435
d1b0na1	A	P06533	GO:0045892
d1b0na1	A	P06533	GO:0046983
d1b0na1	A	P23308	GO:0003677
d1b0na1	A	P23308	GO:0003700
d1b0na1	A	P23308	GO:0006355
d1b0na1	A	P23308	GO:0010629
d1b0na1	A	P23308	GO:0030435
d1b0na1	A	P23308	GO:0045892
d1b0na1	A	P23308	GO:0046983
d1b0na1	A	P06533	GO:0003677
d1b0na1	A	P06533	GO:0003700
d1b0na1	A	P06533	GO:0006355
d1b0na1	A	P06533	GO:0010629
d1b0na1	A	P06533	GO:0030435
d1b0na1	A	P06533	GO:0045892
d1b0na1	A	P06533	GO:0046983
d1b0na1	A	P23308	GO:0003677
d1b0na1	A	P23308	GO:0003700
d1b0na1	A	P23308	GO:0006355
d1b0na1	A	P23308	GO:0010629
d1b0na1	A	P23308	GO:0030435
d1b0na1	A	P23308	GO:0045892
d1b0na1	A	P23308	GO:0046983
d1b0na1	A	P06533	GO:0003677
d1b0na1	A	P06533	GO:0003700
d1b0na1	A	P06533	GO:0006355
d1b0na1	A	P06533	GO:0010629
d1b0na1	A	P06533	GO:0030435
d1b0na1	A	P06533	GO:0045892
d1b0na1	A	P06533	GO:0046983
d1b0na1	A	P23308	GO:0003677
d1b0na1	A	P23308	GO:0003700
d1b0na1	A	P23308	GO:0006355
d1b0na1	A	P23308	GO:0010629
d1b0na1	A	P23308	GO:0030435
d1b0na1	A	P23308	GO:0045892
d1b0na1	A	P23308	GO:0046983
d1b0na1	A	P06533	GO:0003677
d1b0na1	A	P06533	GO:0003700
d1b0na1	A	P06533	GO:0006355
d1b0na1	A	P06533	GO:0010629
d1b0na1	A	P06533	GO:0030435
d1b0na1	A	P06533	GO:0045892
d1b0na1	A	P06533	GO:0046983
d1b0na1	A	P23308	GO:0003677
d1b0na1	A	P23308	GO:0003700
d1b0na1	A	P23308	GO:0006355
d1b0na1	A	P23308	GO:0010629
d1b0na1	A	P23308	GO:0030435
d1b0na1	A	P23308	GO:0045892
d1b0na1	A	P23308	GO:0046983
d1b0nb_	B	P06533	GO:0006355
d1b0nb_	B	P06533	GO:0046983
d1b0nb_	B	P23308	GO:0006355
d1b0nb_	B	P23308	GO:0046983
d1b0nb_	B	P06533	GO:0006355
d1b0nb_	B	P06533	GO:0046983
d1b0nb_	B	P23308	GO:0006355
d1b0nb_	B	P23308	GO:0046983
d1b0nb_	B	P06533	GO:0006355
d1b0nb_	B	P06533	GO:0046983
d1b0nb_	B	P23308	GO:0006355
d1b0nb_	B	P23308	GO:0046983
d1b0nb_	B	P06533	GO:0006355
d1b0nb_	B	P06533	GO:0046983
d1b0nb_	B	P23308	GO:0006355
d1b0nb_	B	P23308	GO:0046983

									10										20										30
-	-	L	D	S	E	W	E	K	L	V	R	D	A	M	T	S	G	V	S	K	K	Q	F	R	E	F	L	D	Y	Q	K	W	R	K	S	Q
F	E	L	D	Q	E	W	V	E	L	M	V	E	A	K	E	A	N	I	S	P	E	E	I	R	K	Y	L	L	L	N	-	-	-	-	-	-

									10										20										30
-	-	L	D	S	E	W	E	K	L	V	R	D	A	M	T	S	G	V	S	K	K	Q	F	R	E	F	L	D	Y	Q	K	W	R	K	S	Q
F	E	L	D	Q	E	W	V	E	L	M	V	E	A	K	E	A	N	I	S	P	E	E	I	R	K	Y	L	L	L	N	-	-	-	-	-	-

									10										20										30
-	-	L	D	S	E	W	E	K	L	V	R	D	A	M	T	S	G	V	S	K	K	Q	F	R	E	F	L	D	Y	Q	K	W	R	K	S	Q
F	E	L	D	Q	E	W	V	E	L	M	V	E	A	K	E	A	N	I	S	P	E	E	I	R	K	Y	L	L	L	N	-	-	-	-	-	-