PASS2.8 - Home

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x

beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x

hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x

                             10        20        30        40        50  
d1u96a-  (   1 )    mtetdkkqeqenhaecedkpkpcc-vckpekeerdtcilfngqdsekcke
d2hp8a-  (   1 )                        mpqkdpÇqkqAceiqkçlqansymeskÇqa
                                                aaaaaaaaaaaa        aa

                             60        70        80       
d1u96a-  (  50 )    fiekykecMkgy---------gfevpsa---------n
d2hp8a-  (  31 )    viqelRkçÇaqypkgrSvvÇsgFekeEeenltrksask
                    aaaaaaaaa

Domains
Outliers

Domain ID	Name	Family	Source	Domain	STRING-DB
d1u96a- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1u96a- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Cytochrome C oxidase copper chaperone, COX17	COX17-like	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]		view
d2hp8a- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2hp8a- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	p8-MTCP1	p8-MTCP1	Human (Homo sapiens) [TaxId: 9606]		view

No outliers

Feature	Download
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

									10										20										30										40										50										60										70										80
M	T	E	T	D	K	K	Q	E	Q	E	N	H	A	E	C	E	D	K	P	K	P	C	C	-	V	C	K	P	E	K	E	E	R	D	T	C	I	L	F	N	G	Q	D	S	E	K	C	K	E	F	I	E	K	Y	K	E	C	M	K	G	Y	-	-	-	-	-	-	-	-	-	G	F	E	V	P	S	A	-	-	-	-	-	-	-	-	-	N
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	P	Q	K	D	P	C	Q	K	Q	A	C	E	I	Q	K	C	L	Q	A	N	S	Y	M	E	S	K	C	Q	A	V	I	Q	E	L	R	K	C	C	A	Q	Y	P	K	G	R	S	V	V	C	S	G	F	E	K	E	E	E	E	N	L	T	R	K	S	A	S	K

Member	Chain	UniProtKB	GO term
d1u96a_	A	Q12287	GO:0005507
d1u96a_	A	Q12287	GO:0005739
d1u96a_	A	Q12287	GO:0005758
d1u96a_	A	Q12287	GO:0005829
d1u96a_	A	Q12287	GO:0015680
d1u96a_	A	Q12287	GO:0016531
d1u96a_	A	Q12287	GO:0018343
d1u96a_	A	Q12287	GO:0033617
d1u96a_	A	Q12287	GO:0046872
d1u96a_	A	Q12287	GO:1903136
d2hp8a_	A	P56277	GO:0005739
d2hp8a_	A	P56277	GO:0005758

									10										20										30										40										50										60										70										80
M	T	E	T	D	K	K	Q	E	Q	E	N	H	A	E	C	E	D	K	P	K	P	C	C	-	V	C	K	P	E	K	E	E	R	D	T	C	I	L	F	N	G	Q	D	S	E	K	C	K	E	F	I	E	K	Y	K	E	C	M	K	G	Y	-	-	-	-	-	-	-	-	-	G	F	E	V	P	S	A	-	-	-	-	-	-	-	-	-	N
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	P	Q	K	D	P	C	Q	K	Q	A	C	E	I	Q	K	C	L	Q	A	N	S	Y	M	E	S	K	C	Q	A	V	I	Q	E	L	R	K	C	C	A	Q	Y	P	K	G	R	S	V	V	C	S	G	F	E	K	E	E	E	E	N	L	T	R	K	S	A	S	K

									10										20										30										40										50										60										70										80
M	T	E	T	D	K	K	Q	E	Q	E	N	H	A	E	C	E	D	K	P	K	P	C	C	-	V	C	K	P	E	K	E	E	R	D	T	C	I	L	F	N	G	Q	D	S	E	K	C	K	E	F	I	E	K	Y	K	E	C	M	K	G	Y	-	-	-	-	-	-	-	-	-	G	F	E	V	P	S	A	-	-	-	-	-	-	-	-	-	N
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	P	Q	K	D	P	C	Q	K	Q	A	C	E	I	Q	K	C	L	Q	A	N	S	Y	M	E	S	K	C	Q	A	V	I	Q	E	L	R	K	C	C	A	Q	Y	P	K	G	R	S	V	V	C	S	G	F	E	K	E	E	E	E	N	L	T	R	K	S	A	S	K

									10										20										30										40										50										60										70										80
M	T	E	T	D	K	K	Q	E	Q	E	N	H	A	E	C	E	D	K	P	K	P	C	C	-	V	C	K	P	E	K	E	E	R	D	T	C	I	L	F	N	G	Q	D	S	E	K	C	K	E	F	I	E	K	Y	K	E	C	M	K	G	Y	-	-	-	-	-	-	-	-	-	G	F	E	V	P	S	A	-	-	-	-	-	-	-	-	-	N
-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	M	P	Q	K	D	P	C	Q	K	Q	A	C	E	I	Q	K	C	L	Q	A	N	S	Y	M	E	S	K	C	Q	A	V	I	Q	E	L	R	K	C	C	A	Q	Y	P	K	G	R	S	V	V	C	S	G	F	E	K	E	E	E	E	N	L	T	R	K	S	A	S	K