Superfamily : 46548 [ alpha-helical ferredoxin ]
Class : All alpha proteins
Fold : Globin-like
# of Members : 5
solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x
beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x
hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x
 
                             10        20        30        40        50  
d1kf6b1  ( 106 )                                                      
d2bs2b1  ( 107 )                                                      
d2h88b2  ( 115 )                                                      
d6lumb2  ( 133 )                                                      
d7m32a1  (   3 )    pvlskdvadiesilalnptqshaalhstlakkldkkhwkrnpdkncfhce
                                                                      

                             60        70        80        90        100 
d1kf6b1  ( 106 )               m-thFieSleaIkpyiign-srtadqgtniQtpaqmakY
d2bs2b1  ( 107 )               tgnwFngMsqrVeswihaqkehdiskleeriepevaqev
d2h88b2  ( 115 )               l-snFyaqyksIepylkkkdeskqgkeqylqsiedrqkL
d6lumb2  ( 133 )               m-epffdayraVkPflvts--gnpptkeriqsptdrarY
d7m32a1  (  55 )    lennfdikhttlg--ergAlreAmrclkca--------------------
                                 aaaaaaaaa                        aa  

                             110       120       130       140       150 
d1kf6b1  ( 143 )    hqfsgcincGlcyaAcpqfglnp-eFiGPAAITlAHryneDsrDhG-kke
d2bs2b1  ( 146 )    feLdrciecgcciaacgTkimre-dFVGAAGLNrVVrfMiDphDertded
d2h88b2  ( 153 )    dglyecilcAccStscpsywwngdkYlGPAVLMqAyrwMiDsrDdy-t-e
d6lumb2  ( 169 )    ddTtkcilcAccTtscpvywse-gsYfGPAAIVnAHrfIfDsrDea-aae
d7m32a1  (  84 )    --------------dApcqkscpthLdIksFItsIsn--------knyyg
                                    aaaa        aaaaaaaaaaa         aa

                             160       170       180       190       200 
d1kf6b1  ( 191 )    RMaqLns-----qnGVwsctfvgycsevcpk-----hVdPaaAIqqgkve
d2bs2b1  ( 195 )    YyelIGd-----ddGVfgcmtllachdvcpk-----nLpLqskiayLrrk
d2h88b2  ( 202 )    rLaqLqd-----pfsLyrchtimnctrtcpk-----glnPgkAIaeIkkm
d6lumb2  ( 217 )    RldiLne-----vdGVwrcrttfnCteacpr-----gIqVtqAIqeVkra
d7m32a1  ( 112 )    AAkmIfsdnplGltcGmvcptsdlcvggcnLyateegsInIgGLqQfASe
                    aaaa                   aaaaa           aaaaaaaaaaa

                             210       220 
d1kf6b1  ( 231 )    Sskdfliat---------lkpr
d2bs2b1  ( 235 )    Mvsvn                 
d2h88b2  ( 242 )    Matyk                 
d6lumb2  ( 257 )    Lmfa                  
d7m32a1  ( 162 )    vfkamnipqirnpclpsqekmp
                    aa                    

 

 

Domain IDNameFamilySourceDomainSTRING-DB
Fumarate reductaseFumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domainEscherichia coli [TaxId: 562]view
automated matchesFumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domainWolinella succinogenes [TaxId: 844]view
Succinate dehydogenaseFumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domainChicken (Gallus gallus) [TaxId: 9031]view
automated matchesautomated matchesMycolicibacterium smegmatis [TaxId: 1445611]view
Dihydropyrimidine dehydrogenase, N-terminal domainDihydropyrimidine dehydrogenase, N-terminal domainPig (Sus scrofa) [TaxId: 9823]view

 

No outliers

FeatureDownload
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

 

10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200 210 220
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M - T H F I E S L E A I K P Y I I G N - S R T A D Q G T N I Q T P A Q M A K Y H Q F S G C I N C G L C Y A A C P Q F G L N P - E F I G P A A I T L A H R Y N E D S R D H G - K K E R M A Q L N S - - - - - Q N G V W S C T F V G Y C S E V C P K - - - - - H V D P A A A I Q Q G K V E S S K D F L I A T - - - - - - - - - L K P R
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - T G N W F N G M S Q R V E S W I H A Q K E H D I S K L E E R I E P E V A Q E V F E L D R C I E C G C C I A A C G T K I M R E - D F V G A A G L N R V V R F M I D P H D E R T D E D Y Y E L I G D - - - - - D D G V F G C M T L L A C H D V C P K - - - - - N L P L Q S K I A Y L R R K M V S V N - - - - - - - - - - - - - - - - -
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - L - S N F Y A Q Y K S I E P Y L K K K D E S K Q G K E Q Y L Q S I E D R Q K L D G L Y E C I L C A C C S T S C P S Y W W N G D K Y L G P A V L M Q A Y R W M I D S R D D Y - T - E R L A Q L Q D - - - - - P F S L Y R C H T I M N C T R T C P K - - - - - G L N P G K A I A E I K K M M A T Y K - - - - - - - - - - - - - - - - -
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - M - E P F F D A Y R A V K P F L V T S - - G N P P T K E R I Q S P T D R A R Y D D T T K C I L C A C C T T S C P V Y W S E - G S Y F G P A A I V N A H R F I F D S R D E A - A A E R L D I L N E - - - - - V D G V W R C R T T F N C T E A C P R - - - - - G I Q V T Q A I Q E V K R A L M F A - - - - - - - - - - - - - - - - - -
P V L S K D V A D I E S I L A L N P T Q S H A A L H S T L A K K L D K K H W K R N P D K N C F H C E L E N N F D I K H T T L G - - E R G A L R E A M R C L K C A - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - D A P C Q K S C P T H L D I K S F I T S I S N - - - - - - - - K N Y Y G A A K M I F S D N P L G L T C G M V C P T S D L C V G G C N L Y A T E E G S I N I G G L Q Q F A S E V F K A M N I P Q I R N P C L P S Q E K M P

 

 

 

 

 

Member Chain UniProtKB GO term
d1kf6b1 B P00363 GO:0005515
d1kf6b1 B P00363 GO:0005829
d1kf6b1 B P00363 GO:0005886
d1kf6b1 B P00363 GO:0006113
d1kf6b1 B P00363 GO:0008177
d1kf6b1 B P00363 GO:0009055
d1kf6b1 B P00363 GO:0009061
d1kf6b1 B P00363 GO:0016020
d1kf6b1 B P00363 GO:0016491
d1kf6b1 B P00363 GO:0019645
d1kf6b1 B P00363 GO:0044780
d1kf6b1 B P00363 GO:0045283
d1kf6b1 B P00363 GO:0006099
d1kf6b1 B P00363 GO:0046872
d1kf6b1 B P00363 GO:0051536
d1kf6b1 B P00363 GO:0051537
d1kf6b1 B P00363 GO:0051538
d1kf6b1 B P00363 GO:0051539
d1kf6b1 B P0AC47 GO:0005515
d1kf6b1 B P0AC47 GO:0005829
d1kf6b1 B P0AC47 GO:0005886
d1kf6b1 B P0AC47 GO:0006113
d1kf6b1 B P0AC47 GO:0008177
d1kf6b1 B P0AC47 GO:0009055
d1kf6b1 B P0AC47 GO:0009061
d1kf6b1 B P0AC47 GO:0016020
d1kf6b1 B P0AC47 GO:0016491
d1kf6b1 B P0AC47 GO:0019645
d1kf6b1 B P0AC47 GO:0044780
d1kf6b1 B P0AC47 GO:0045283
d1kf6b1 B P0AC47 GO:0006099
d1kf6b1 B P0AC47 GO:0046872
d1kf6b1 B P0AC47 GO:0051536
d1kf6b1 B P0AC47 GO:0051537
d1kf6b1 B P0AC47 GO:0051538
d1kf6b1 B P0AC47 GO:0051539
d1kf6b1 B P0A8Q0 GO:0005515
d1kf6b1 B P0A8Q0 GO:0005829
d1kf6b1 B P0A8Q0 GO:0005886
d1kf6b1 B P0A8Q0 GO:0006113
d1kf6b1 B P0A8Q0 GO:0008177
d1kf6b1 B P0A8Q0 GO:0009055
d1kf6b1 B P0A8Q0 GO:0009061
d1kf6b1 B P0A8Q0 GO:0016020
d1kf6b1 B P0A8Q0 GO:0016491
d1kf6b1 B P0A8Q0 GO:0019645
d1kf6b1 B P0A8Q0 GO:0044780
d1kf6b1 B P0A8Q0 GO:0045283
d1kf6b1 B P0A8Q0 GO:0006099
d1kf6b1 B P0A8Q0 GO:0046872
d1kf6b1 B P0A8Q0 GO:0051536
d1kf6b1 B P0A8Q0 GO:0051537
d1kf6b1 B P0A8Q0 GO:0051538
d1kf6b1 B P0A8Q0 GO:0051539
d1kf6b1 B P0A8Q3 GO:0005515
d1kf6b1 B P0A8Q3 GO:0005829
d1kf6b1 B P0A8Q3 GO:0005886
d1kf6b1 B P0A8Q3 GO:0006113
d1kf6b1 B P0A8Q3 GO:0008177
d1kf6b1 B P0A8Q3 GO:0009055
d1kf6b1 B P0A8Q3 GO:0009061
d1kf6b1 B P0A8Q3 GO:0016020
d1kf6b1 B P0A8Q3 GO:0016491
d1kf6b1 B P0A8Q3 GO:0019645
d1kf6b1 B P0A8Q3 GO:0044780
d1kf6b1 B P0A8Q3 GO:0045283
d1kf6b1 B P0A8Q3 GO:0006099
d1kf6b1 B P0A8Q3 GO:0046872
d1kf6b1 B P0A8Q3 GO:0051536
d1kf6b1 B P0A8Q3 GO:0051537
d1kf6b1 B P0A8Q3 GO:0051538
d1kf6b1 B P0A8Q3 GO:0051539
d1kf6b1 B P00363 GO:0005515
d1kf6b1 B P00363 GO:0005829
d1kf6b1 B P00363 GO:0005886
d1kf6b1 B P00363 GO:0006113
d1kf6b1 B P00363 GO:0008177
d1kf6b1 B P00363 GO:0009055
d1kf6b1 B P00363 GO:0009061
d1kf6b1 B P00363 GO:0016020
d1kf6b1 B P00363 GO:0016491
d1kf6b1 B P00363 GO:0019645
d1kf6b1 B P00363 GO:0044780
d1kf6b1 B P00363 GO:0045283
d1kf6b1 B P00363 GO:0006099
d1kf6b1 B P00363 GO:0046872
d1kf6b1 B P00363 GO:0051536
d1kf6b1 B P00363 GO:0051537
d1kf6b1 B P00363 GO:0051538
d1kf6b1 B P00363 GO:0051539
d1kf6b1 B P0AC47 GO:0005515
d1kf6b1 B P0AC47 GO:0005829
d1kf6b1 B P0AC47 GO:0005886
d1kf6b1 B P0AC47 GO:0006113
d1kf6b1 B P0AC47 GO:0008177
d1kf6b1 B P0AC47 GO:0009055
d1kf6b1 B P0AC47 GO:0009061
d1kf6b1 B P0AC47 GO:0016020
d1kf6b1 B P0AC47 GO:0016491
d1kf6b1 B P0AC47 GO:0019645
d1kf6b1 B P0AC47 GO:0044780
d1kf6b1 B P0AC47 GO:0045283
d1kf6b1 B P0AC47 GO:0006099
d1kf6b1 B P0AC47 GO:0046872
d1kf6b1 B P0AC47 GO:0051536
d1kf6b1 B P0AC47 GO:0051537
d1kf6b1 B P0AC47 GO:0051538
d1kf6b1 B P0AC47 GO:0051539
d1kf6b1 B P0A8Q0 GO:0005515
d1kf6b1 B P0A8Q0 GO:0005829
d1kf6b1 B P0A8Q0 GO:0005886
d1kf6b1 B P0A8Q0 GO:0006113
d1kf6b1 B P0A8Q0 GO:0008177
d1kf6b1 B P0A8Q0 GO:0009055
d1kf6b1 B P0A8Q0 GO:0009061
d1kf6b1 B P0A8Q0 GO:0016020
d1kf6b1 B P0A8Q0 GO:0016491
d1kf6b1 B P0A8Q0 GO:0019645
d1kf6b1 B P0A8Q0 GO:0044780
d1kf6b1 B P0A8Q0 GO:0045283
d1kf6b1 B P0A8Q0 GO:0006099
d1kf6b1 B P0A8Q0 GO:0046872
d1kf6b1 B P0A8Q0 GO:0051536
d1kf6b1 B P0A8Q0 GO:0051537
d1kf6b1 B P0A8Q0 GO:0051538
d1kf6b1 B P0A8Q0 GO:0051539
d1kf6b1 B P0A8Q3 GO:0005515
d1kf6b1 B P0A8Q3 GO:0005829
d1kf6b1 B P0A8Q3 GO:0005886
d1kf6b1 B P0A8Q3 GO:0006113
d1kf6b1 B P0A8Q3 GO:0008177
d1kf6b1 B P0A8Q3 GO:0009055
d1kf6b1 B P0A8Q3 GO:0009061
d1kf6b1 B P0A8Q3 GO:0016020
d1kf6b1 B P0A8Q3 GO:0016491
d1kf6b1 B P0A8Q3 GO:0019645
d1kf6b1 B P0A8Q3 GO:0044780
d1kf6b1 B P0A8Q3 GO:0045283
d1kf6b1 B P0A8Q3 GO:0006099
d1kf6b1 B P0A8Q3 GO:0046872
d1kf6b1 B P0A8Q3 GO:0051536
d1kf6b1 B P0A8Q3 GO:0051537
d1kf6b1 B P0A8Q3 GO:0051538
d1kf6b1 B P0A8Q3 GO:0051539
d1kf6b1 B P00363 GO:0005515
d1kf6b1 B P00363 GO:0005829
d1kf6b1 B P00363 GO:0005886
d1kf6b1 B P00363 GO:0006113
d1kf6b1 B P00363 GO:0008177
d1kf6b1 B P00363 GO:0009055
d1kf6b1 B P00363 GO:0009061
d1kf6b1 B P00363 GO:0016020
d1kf6b1 B P00363 GO:0016491
d1kf6b1 B P00363 GO:0019645
d1kf6b1 B P00363 GO:0044780
d1kf6b1 B P00363 GO:0045283
d1kf6b1 B P00363 GO:0006099
d1kf6b1 B P00363 GO:0046872
d1kf6b1 B P00363 GO:0051536
d1kf6b1 B P00363 GO:0051537
d1kf6b1 B P00363 GO:0051538
d1kf6b1 B P00363 GO:0051539
d1kf6b1 B P0AC47 GO:0005515
d1kf6b1 B P0AC47 GO:0005829
d1kf6b1 B P0AC47 GO:0005886
d1kf6b1 B P0AC47 GO:0006113
d1kf6b1 B P0AC47 GO:0008177
d1kf6b1 B P0AC47 GO:0009055
d1kf6b1 B P0AC47 GO:0009061
d1kf6b1 B P0AC47 GO:0016020
d1kf6b1 B P0AC47 GO:0016491
d1kf6b1 B P0AC47 GO:0019645
d1kf6b1 B P0AC47 GO:0044780
d1kf6b1 B P0AC47 GO:0045283
d1kf6b1 B P0AC47 GO:0006099
d1kf6b1 B P0AC47 GO:0046872
d1kf6b1 B P0AC47 GO:0051536
d1kf6b1 B P0AC47 GO:0051537
d1kf6b1 B P0AC47 GO:0051538
d1kf6b1 B P0AC47 GO:0051539
d1kf6b1 B P0A8Q0 GO:0005515
d1kf6b1 B P0A8Q0 GO:0005829
d1kf6b1 B P0A8Q0 GO:0005886
d1kf6b1 B P0A8Q0 GO:0006113
d1kf6b1 B P0A8Q0 GO:0008177
d1kf6b1 B P0A8Q0 GO:0009055
d1kf6b1 B P0A8Q0 GO:0009061
d1kf6b1 B P0A8Q0 GO:0016020
d1kf6b1 B P0A8Q0 GO:0016491
d1kf6b1 B P0A8Q0 GO:0019645
d1kf6b1 B P0A8Q0 GO:0044780
d1kf6b1 B P0A8Q0 GO:0045283
d1kf6b1 B P0A8Q0 GO:0006099
d1kf6b1 B P0A8Q0 GO:0046872
d1kf6b1 B P0A8Q0 GO:0051536
d1kf6b1 B P0A8Q0 GO:0051537
d1kf6b1 B P0A8Q0 GO:0051538
d1kf6b1 B P0A8Q0 GO:0051539
d1kf6b1 B P0A8Q3 GO:0005515
d1kf6b1 B P0A8Q3 GO:0005829
d1kf6b1 B P0A8Q3 GO:0005886
d1kf6b1 B P0A8Q3 GO:0006113
d1kf6b1 B P0A8Q3 GO:0008177
d1kf6b1 B P0A8Q3 GO:0009055
d1kf6b1 B P0A8Q3 GO:0009061
d1kf6b1 B P0A8Q3 GO:0016020
d1kf6b1 B P0A8Q3 GO:0016491
d1kf6b1 B P0A8Q3 GO:0019645
d1kf6b1 B P0A8Q3 GO:0044780
d1kf6b1 B P0A8Q3 GO:0045283
d1kf6b1 B P0A8Q3 GO:0006099
d1kf6b1 B P0A8Q3 GO:0046872
d1kf6b1 B P0A8Q3 GO:0051536
d1kf6b1 B P0A8Q3 GO:0051537
d1kf6b1 B P0A8Q3 GO:0051538
d1kf6b1 B P0A8Q3 GO:0051539
d1kf6b1 B P00363 GO:0005515
d1kf6b1 B P00363 GO:0005829
d1kf6b1 B P00363 GO:0005886
d1kf6b1 B P00363 GO:0006113
d1kf6b1 B P00363 GO:0008177
d1kf6b1 B P00363 GO:0009055
d1kf6b1 B P00363 GO:0009061
d1kf6b1 B P00363 GO:0016020
d1kf6b1 B P00363 GO:0016491
d1kf6b1 B P00363 GO:0019645
d1kf6b1 B P00363 GO:0044780
d1kf6b1 B P00363 GO:0045283
d1kf6b1 B P00363 GO:0006099
d1kf6b1 B P00363 GO:0046872
d1kf6b1 B P00363 GO:0051536
d1kf6b1 B P00363 GO:0051537
d1kf6b1 B P00363 GO:0051538
d1kf6b1 B P00363 GO:0051539
d1kf6b1 B P0AC47 GO:0005515
d1kf6b1 B P0AC47 GO:0005829
d1kf6b1 B P0AC47 GO:0005886
d1kf6b1 B P0AC47 GO:0006113
d1kf6b1 B P0AC47 GO:0008177
d1kf6b1 B P0AC47 GO:0009055
d1kf6b1 B P0AC47 GO:0009061
d1kf6b1 B P0AC47 GO:0016020
d1kf6b1 B P0AC47 GO:0016491
d1kf6b1 B P0AC47 GO:0019645
d1kf6b1 B P0AC47 GO:0044780
d1kf6b1 B P0AC47 GO:0045283
d1kf6b1 B P0AC47 GO:0006099
d1kf6b1 B P0AC47 GO:0046872
d1kf6b1 B P0AC47 GO:0051536
d1kf6b1 B P0AC47 GO:0051537
d1kf6b1 B P0AC47 GO:0051538
d1kf6b1 B P0AC47 GO:0051539
d1kf6b1 B P0A8Q0 GO:0005515
d1kf6b1 B P0A8Q0 GO:0005829
d1kf6b1 B P0A8Q0 GO:0005886
d1kf6b1 B P0A8Q0 GO:0006113
d1kf6b1 B P0A8Q0 GO:0008177
d1kf6b1 B P0A8Q0 GO:0009055
d1kf6b1 B P0A8Q0 GO:0009061
d1kf6b1 B P0A8Q0 GO:0016020
d1kf6b1 B P0A8Q0 GO:0016491
d1kf6b1 B P0A8Q0 GO:0019645
d1kf6b1 B P0A8Q0 GO:0044780
d1kf6b1 B P0A8Q0 GO:0045283
d1kf6b1 B P0A8Q0 GO:0006099
d1kf6b1 B P0A8Q0 GO:0046872
d1kf6b1 B P0A8Q0 GO:0051536
d1kf6b1 B P0A8Q0 GO:0051537
d1kf6b1 B P0A8Q0 GO:0051538
d1kf6b1 B P0A8Q0 GO:0051539
d1kf6b1 B P0A8Q3 GO:0005515
d1kf6b1 B P0A8Q3 GO:0005829
d1kf6b1 B P0A8Q3 GO:0005886
d1kf6b1 B P0A8Q3 GO:0006113
d1kf6b1 B P0A8Q3 GO:0008177
d1kf6b1 B P0A8Q3 GO:0009055
d1kf6b1 B P0A8Q3 GO:0009061
d1kf6b1 B P0A8Q3 GO:0016020
d1kf6b1 B P0A8Q3 GO:0016491
d1kf6b1 B P0A8Q3 GO:0019645
d1kf6b1 B P0A8Q3 GO:0044780
d1kf6b1 B P0A8Q3 GO:0045283
d1kf6b1 B P0A8Q3 GO:0006099
d1kf6b1 B P0A8Q3 GO:0046872
d1kf6b1 B P0A8Q3 GO:0051536
d1kf6b1 B P0A8Q3 GO:0051537
d1kf6b1 B P0A8Q3 GO:0051538
d1kf6b1 B P0A8Q3 GO:0051539
d1kf6b1 B P00363 GO:0005515
d1kf6b1 B P00363 GO:0005829
d1kf6b1 B P00363 GO:0005886
d1kf6b1 B P00363 GO:0006113
d1kf6b1 B P00363 GO:0008177
d1kf6b1 B P00363 GO:0009055
d1kf6b1 B P00363 GO:0009061
d1kf6b1 B P00363 GO:0016020
d1kf6b1 B P00363 GO:0016491
d1kf6b1 B P00363 GO:0019645
d1kf6b1 B P00363 GO:0044780
d1kf6b1 B P00363 GO:0045283
d1kf6b1 B P00363 GO:0006099
d1kf6b1 B P00363 GO:0046872
d1kf6b1 B P00363 GO:0051536
d1kf6b1 B P00363 GO:0051537
d1kf6b1 B P00363 GO:0051538
d1kf6b1 B P00363 GO:0051539
d1kf6b1 B P0AC47 GO:0005515
d1kf6b1 B P0AC47 GO:0005829
d1kf6b1 B P0AC47 GO:0005886
d1kf6b1 B P0AC47 GO:0006113
d1kf6b1 B P0AC47 GO:0008177
d1kf6b1 B P0AC47 GO:0009055
d1kf6b1 B P0AC47 GO:0009061
d1kf6b1 B P0AC47 GO:0016020
d1kf6b1 B P0AC47 GO:0016491
d1kf6b1 B P0AC47 GO:0019645
d1kf6b1 B P0AC47 GO:0044780
d1kf6b1 B P0AC47 GO:0045283
d1kf6b1 B P0AC47 GO:0006099
d1kf6b1 B P0AC47 GO:0046872
d1kf6b1 B P0AC47 GO:0051536
d1kf6b1 B P0AC47 GO:0051537
d1kf6b1 B P0AC47 GO:0051538
d1kf6b1 B P0AC47 GO:0051539
d1kf6b1 B P0A8Q0 GO:0005515
d1kf6b1 B P0A8Q0 GO:0005829
d1kf6b1 B P0A8Q0 GO:0005886
d1kf6b1 B P0A8Q0 GO:0006113
d1kf6b1 B P0A8Q0 GO:0008177
d1kf6b1 B P0A8Q0 GO:0009055
d1kf6b1 B P0A8Q0 GO:0009061
d1kf6b1 B P0A8Q0 GO:0016020
d1kf6b1 B P0A8Q0 GO:0016491
d1kf6b1 B P0A8Q0 GO:0019645
d1kf6b1 B P0A8Q0 GO:0044780
d1kf6b1 B P0A8Q0 GO:0045283
d1kf6b1 B P0A8Q0 GO:0006099
d1kf6b1 B P0A8Q0 GO:0046872
d1kf6b1 B P0A8Q0 GO:0051536
d1kf6b1 B P0A8Q0 GO:0051537
d1kf6b1 B P0A8Q0 GO:0051538
d1kf6b1 B P0A8Q0 GO:0051539
d1kf6b1 B P0A8Q3 GO:0005515
d1kf6b1 B P0A8Q3 GO:0005829
d1kf6b1 B P0A8Q3 GO:0005886
d1kf6b1 B P0A8Q3 GO:0006113
d1kf6b1 B P0A8Q3 GO:0008177
d1kf6b1 B P0A8Q3 GO:0009055
d1kf6b1 B P0A8Q3 GO:0009061
d1kf6b1 B P0A8Q3 GO:0016020
d1kf6b1 B P0A8Q3 GO:0016491
d1kf6b1 B P0A8Q3 GO:0019645
d1kf6b1 B P0A8Q3 GO:0044780
d1kf6b1 B P0A8Q3 GO:0045283
d1kf6b1 B P0A8Q3 GO:0006099
d1kf6b1 B P0A8Q3 GO:0046872
d1kf6b1 B P0A8Q3 GO:0051536
d1kf6b1 B P0A8Q3 GO:0051537
d1kf6b1 B P0A8Q3 GO:0051538
d1kf6b1 B P0A8Q3 GO:0051539
d1kf6b1 B P00363 GO:0005515
d1kf6b1 B P00363 GO:0005829
d1kf6b1 B P00363 GO:0005886
d1kf6b1 B P00363 GO:0006113
d1kf6b1 B P00363 GO:0008177
d1kf6b1 B P00363 GO:0009055
d1kf6b1 B P00363 GO:0009061
d1kf6b1 B P00363 GO:0016020
d1kf6b1 B P00363 GO:0016491
d1kf6b1 B P00363 GO:0019645
d1kf6b1 B P00363 GO:0044780
d1kf6b1 B P00363 GO:0045283
d1kf6b1 B P00363 GO:0006099
d1kf6b1 B P00363 GO:0046872
d1kf6b1 B P00363 GO:0051536
d1kf6b1 B P00363 GO:0051537
d1kf6b1 B P00363 GO:0051538
d1kf6b1 B P00363 GO:0051539
d1kf6b1 B P0AC47 GO:0005515
d1kf6b1 B P0AC47 GO:0005829
d1kf6b1 B P0AC47 GO:0005886
d1kf6b1 B P0AC47 GO:0006113
d1kf6b1 B P0AC47 GO:0008177
d1kf6b1 B P0AC47 GO:0009055
d1kf6b1 B P0AC47 GO:0009061
d1kf6b1 B P0AC47 GO:0016020
d1kf6b1 B P0AC47 GO:0016491
d1kf6b1 B P0AC47 GO:0019645
d1kf6b1 B P0AC47 GO:0044780
d1kf6b1 B P0AC47 GO:0045283
d1kf6b1 B P0AC47 GO:0006099
d1kf6b1 B P0AC47 GO:0046872
d1kf6b1 B P0AC47 GO:0051536
d1kf6b1 B P0AC47 GO:0051537
d1kf6b1 B P0AC47 GO:0051538
d1kf6b1 B P0AC47 GO:0051539
d1kf6b1 B P0A8Q0 GO:0005515
d1kf6b1 B P0A8Q0 GO:0005829
d1kf6b1 B P0A8Q0 GO:0005886
d1kf6b1 B P0A8Q0 GO:0006113
d1kf6b1 B P0A8Q0 GO:0008177
d1kf6b1 B P0A8Q0 GO:0009055
d1kf6b1 B P0A8Q0 GO:0009061
d1kf6b1 B P0A8Q0 GO:0016020
d1kf6b1 B P0A8Q0 GO:0016491
d1kf6b1 B P0A8Q0 GO:0019645
d1kf6b1 B P0A8Q0 GO:0044780
d1kf6b1 B P0A8Q0 GO:0045283
d1kf6b1 B P0A8Q0 GO:0006099
d1kf6b1 B P0A8Q0 GO:0046872
d1kf6b1 B P0A8Q0 GO:0051536
d1kf6b1 B P0A8Q0 GO:0051537
d1kf6b1 B P0A8Q0 GO:0051538
d1kf6b1 B P0A8Q0 GO:0051539
d1kf6b1 B P0A8Q3 GO:0005515
d1kf6b1 B P0A8Q3 GO:0005829
d1kf6b1 B P0A8Q3 GO:0005886
d1kf6b1 B P0A8Q3 GO:0006113
d1kf6b1 B P0A8Q3 GO:0008177
d1kf6b1 B P0A8Q3 GO:0009055
d1kf6b1 B P0A8Q3 GO:0009061
d1kf6b1 B P0A8Q3 GO:0016020
d1kf6b1 B P0A8Q3 GO:0016491
d1kf6b1 B P0A8Q3 GO:0019645
d1kf6b1 B P0A8Q3 GO:0044780
d1kf6b1 B P0A8Q3 GO:0045283
d1kf6b1 B P0A8Q3 GO:0006099
d1kf6b1 B P0A8Q3 GO:0046872
d1kf6b1 B P0A8Q3 GO:0051536
d1kf6b1 B P0A8Q3 GO:0051537
d1kf6b1 B P0A8Q3 GO:0051538
d1kf6b1 B P0A8Q3 GO:0051539
d2bs2b1 B P17412 GO:0005886
d2bs2b1 B P17412 GO:0009055
d2bs2b1 B P17412 GO:0016491
d2bs2b1 B P17412 GO:0006099
d2bs2b1 B P17412 GO:0009060
d2bs2b1 B P17412 GO:0022904
d2bs2b1 B P17412 GO:0046872
d2bs2b1 B P17412 GO:0051536
d2bs2b1 B P17412 GO:0051537
d2bs2b1 B P17412 GO:0051538
d2bs2b1 B P17412 GO:0051539
d2bs2b1 B P17596 GO:0005886
d2bs2b1 B P17596 GO:0009055
d2bs2b1 B P17596 GO:0016491
d2bs2b1 B P17596 GO:0006099
d2bs2b1 B P17596 GO:0009060
d2bs2b1 B P17596 GO:0022904
d2bs2b1 B P17596 GO:0046872
d2bs2b1 B P17596 GO:0051536
d2bs2b1 B P17596 GO:0051537
d2bs2b1 B P17596 GO:0051538
d2bs2b1 B P17596 GO:0051539
d2bs2b1 B P17413 GO:0005886
d2bs2b1 B P17413 GO:0009055
d2bs2b1 B P17413 GO:0016491
d2bs2b1 B P17413 GO:0006099
d2bs2b1 B P17413 GO:0009060
d2bs2b1 B P17413 GO:0022904
d2bs2b1 B P17413 GO:0046872
d2bs2b1 B P17413 GO:0051536
d2bs2b1 B P17413 GO:0051537
d2bs2b1 B P17413 GO:0051538
d2bs2b1 B P17413 GO:0051539
d2bs2b1 B P17412 GO:0005886
d2bs2b1 B P17412 GO:0009055
d2bs2b1 B P17412 GO:0016491
d2bs2b1 B P17412 GO:0006099
d2bs2b1 B P17412 GO:0009060
d2bs2b1 B P17412 GO:0022904
d2bs2b1 B P17412 GO:0046872
d2bs2b1 B P17412 GO:0051536
d2bs2b1 B P17412 GO:0051537
d2bs2b1 B P17412 GO:0051538
d2bs2b1 B P17412 GO:0051539
d2bs2b1 B P17596 GO:0005886
d2bs2b1 B P17596 GO:0009055
d2bs2b1 B P17596 GO:0016491
d2bs2b1 B P17596 GO:0006099
d2bs2b1 B P17596 GO:0009060
d2bs2b1 B P17596 GO:0022904
d2bs2b1 B P17596 GO:0046872
d2bs2b1 B P17596 GO:0051536
d2bs2b1 B P17596 GO:0051537
d2bs2b1 B P17596 GO:0051538
d2bs2b1 B P17596 GO:0051539
d2bs2b1 B P17413 GO:0005886
d2bs2b1 B P17413 GO:0009055
d2bs2b1 B P17413 GO:0016491
d2bs2b1 B P17413 GO:0006099
d2bs2b1 B P17413 GO:0009060
d2bs2b1 B P17413 GO:0022904
d2bs2b1 B P17413 GO:0046872
d2bs2b1 B P17413 GO:0051536
d2bs2b1 B P17413 GO:0051537
d2bs2b1 B P17413 GO:0051538
d2bs2b1 B P17413 GO:0051539
d2bs2b1 B P17412 GO:0005886
d2bs2b1 B P17412 GO:0009055
d2bs2b1 B P17412 GO:0016491
d2bs2b1 B P17412 GO:0006099
d2bs2b1 B P17412 GO:0009060
d2bs2b1 B P17412 GO:0022904
d2bs2b1 B P17412 GO:0046872
d2bs2b1 B P17412 GO:0051536
d2bs2b1 B P17412 GO:0051537
d2bs2b1 B P17412 GO:0051538
d2bs2b1 B P17412 GO:0051539
d2bs2b1 B P17596 GO:0005886
d2bs2b1 B P17596 GO:0009055
d2bs2b1 B P17596 GO:0016491
d2bs2b1 B P17596 GO:0006099
d2bs2b1 B P17596 GO:0009060
d2bs2b1 B P17596 GO:0022904
d2bs2b1 B P17596 GO:0046872
d2bs2b1 B P17596 GO:0051536
d2bs2b1 B P17596 GO:0051537
d2bs2b1 B P17596 GO:0051538
d2bs2b1 B P17596 GO:0051539
d2bs2b1 B P17413 GO:0005886
d2bs2b1 B P17413 GO:0009055
d2bs2b1 B P17413 GO:0016491
d2bs2b1 B P17413 GO:0006099
d2bs2b1 B P17413 GO:0009060
d2bs2b1 B P17413 GO:0022904
d2bs2b1 B P17413 GO:0046872
d2bs2b1 B P17413 GO:0051536
d2bs2b1 B P17413 GO:0051537
d2bs2b1 B P17413 GO:0051538
d2bs2b1 B P17413 GO:0051539
d2bs2b1 B P17412 GO:0005886
d2bs2b1 B P17412 GO:0009055
d2bs2b1 B P17412 GO:0016491
d2bs2b1 B P17412 GO:0006099
d2bs2b1 B P17412 GO:0009060
d2bs2b1 B P17412 GO:0022904
d2bs2b1 B P17412 GO:0046872
d2bs2b1 B P17412 GO:0051536
d2bs2b1 B P17412 GO:0051537
d2bs2b1 B P17412 GO:0051538
d2bs2b1 B P17412 GO:0051539
d2bs2b1 B P17596 GO:0005886
d2bs2b1 B P17596 GO:0009055
d2bs2b1 B P17596 GO:0016491
d2bs2b1 B P17596 GO:0006099
d2bs2b1 B P17596 GO:0009060
d2bs2b1 B P17596 GO:0022904
d2bs2b1 B P17596 GO:0046872
d2bs2b1 B P17596 GO:0051536
d2bs2b1 B P17596 GO:0051537
d2bs2b1 B P17596 GO:0051538
d2bs2b1 B P17596 GO:0051539
d2bs2b1 B P17413 GO:0005886
d2bs2b1 B P17413 GO:0009055
d2bs2b1 B P17413 GO:0016491
d2bs2b1 B P17413 GO:0006099
d2bs2b1 B P17413 GO:0009060
d2bs2b1 B P17413 GO:0022904
d2bs2b1 B P17413 GO:0046872
d2bs2b1 B P17413 GO:0051536
d2bs2b1 B P17413 GO:0051537
d2bs2b1 B P17413 GO:0051538
d2bs2b1 B P17413 GO:0051539
d2bs2b1 B P17412 GO:0005886
d2bs2b1 B P17412 GO:0009055
d2bs2b1 B P17412 GO:0016491
d2bs2b1 B P17412 GO:0006099
d2bs2b1 B P17412 GO:0009060
d2bs2b1 B P17412 GO:0022904
d2bs2b1 B P17412 GO:0046872
d2bs2b1 B P17412 GO:0051536
d2bs2b1 B P17412 GO:0051537
d2bs2b1 B P17412 GO:0051538
d2bs2b1 B P17412 GO:0051539
d2bs2b1 B P17596 GO:0005886
d2bs2b1 B P17596 GO:0009055
d2bs2b1 B P17596 GO:0016491
d2bs2b1 B P17596 GO:0006099
d2bs2b1 B P17596 GO:0009060
d2bs2b1 B P17596 GO:0022904
d2bs2b1 B P17596 GO:0046872
d2bs2b1 B P17596 GO:0051536
d2bs2b1 B P17596 GO:0051537
d2bs2b1 B P17596 GO:0051538
d2bs2b1 B P17596 GO:0051539
d2bs2b1 B P17413 GO:0005886
d2bs2b1 B P17413 GO:0009055
d2bs2b1 B P17413 GO:0016491
d2bs2b1 B P17413 GO:0006099
d2bs2b1 B P17413 GO:0009060
d2bs2b1 B P17413 GO:0022904
d2bs2b1 B P17413 GO:0046872
d2bs2b1 B P17413 GO:0051536
d2bs2b1 B P17413 GO:0051537
d2bs2b1 B P17413 GO:0051538
d2bs2b1 B P17413 GO:0051539
d2bs2b1 B P17412 GO:0005886
d2bs2b1 B P17412 GO:0009055
d2bs2b1 B P17412 GO:0016491
d2bs2b1 B P17412 GO:0006099
d2bs2b1 B P17412 GO:0009060
d2bs2b1 B P17412 GO:0022904
d2bs2b1 B P17412 GO:0046872
d2bs2b1 B P17412 GO:0051536
d2bs2b1 B P17412 GO:0051537
d2bs2b1 B P17412 GO:0051538
d2bs2b1 B P17412 GO:0051539
d2bs2b1 B P17596 GO:0005886
d2bs2b1 B P17596 GO:0009055
d2bs2b1 B P17596 GO:0016491
d2bs2b1 B P17596 GO:0006099
d2bs2b1 B P17596 GO:0009060
d2bs2b1 B P17596 GO:0022904
d2bs2b1 B P17596 GO:0046872
d2bs2b1 B P17596 GO:0051536
d2bs2b1 B P17596 GO:0051537
d2bs2b1 B P17596 GO:0051538
d2bs2b1 B P17596 GO:0051539
d2bs2b1 B P17413 GO:0005886
d2bs2b1 B P17413 GO:0009055
d2bs2b1 B P17413 GO:0016491
d2bs2b1 B P17413 GO:0006099
d2bs2b1 B P17413 GO:0009060
d2bs2b1 B P17413 GO:0022904
d2bs2b1 B P17413 GO:0046872
d2bs2b1 B P17413 GO:0051536
d2bs2b1 B P17413 GO:0051537
d2bs2b1 B P17413 GO:0051538
d2bs2b1 B P17413 GO:0051539