PASS2.8 - Home

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x

beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x

hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x

                             10        20        30        40        50  
d1rh5c-  (  21 )    etfskirvkpehvigvtvafviieailtygrf                  
d3dine-  (   9 )         htiisvaliymvqvqmskfselggafgsgglhtvfgrrkgldtgg
                             aaaaaaaaaaaaaaaaaa                       

                             60        70  
d1rh5c-                                 
d3dine-  (  54 )    kitlvlsvlffvscvvtafv

Domains
Outliers

Domain ID	Name	Family	Source	Domain	STRING-DB
d1rh5c- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d1rh5c- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Sec-beta subunit	Sec-beta subunit	Methanococcus jannaschii [TaxId: 2190]		view
d3dine- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3dine- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	SecG	SecG subunit	Thermotoga sp. [TaxId: 126740]		view

No outliers

Feature	Download
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

									10										20										30										40										50										60										70
E	T	F	S	K	I	R	V	K	P	E	H	V	I	G	V	T	V	A	F	V	I	I	E	A	I	L	T	Y	G	R	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	H	T	I	I	S	V	A	L	I	Y	M	V	Q	V	Q	M	S	K	F	S	E	L	G	G	A	F	G	S	G	G	L	H	T	V	F	G	R	R	K	G	L	D	T	G	G	K	I	T	L	V	L	S	V	L	F	F	V	S	C	V	V	T	A	F	V

Member	Chain	UniProtKB	GO term
d1rh5c_	C	Q60175	GO:0005886
d1rh5c_	C	Q60175	GO:0015031
d1rh5c_	C	Q57817	GO:0005886
d1rh5c_	C	Q57817	GO:0015031
d1rh5c_	C	P60460	GO:0005886
d1rh5c_	C	P60460	GO:0015031
d1rh5c_	C	Q60175	GO:0005886
d1rh5c_	C	Q60175	GO:0015031
d1rh5c_	C	Q57817	GO:0005886
d1rh5c_	C	Q57817	GO:0015031
d1rh5c_	C	P60460	GO:0005886
d1rh5c_	C	P60460	GO:0015031
d1rh5c_	C	Q60175	GO:0005886
d1rh5c_	C	Q60175	GO:0015031
d1rh5c_	C	Q57817	GO:0005886
d1rh5c_	C	Q57817	GO:0015031
d1rh5c_	C	P60460	GO:0005886
d1rh5c_	C	P60460	GO:0015031

									10										20										30										40										50										60										70
E	T	F	S	K	I	R	V	K	P	E	H	V	I	G	V	T	V	A	F	V	I	I	E	A	I	L	T	Y	G	R	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	H	T	I	I	S	V	A	L	I	Y	M	V	Q	V	Q	M	S	K	F	S	E	L	G	G	A	F	G	S	G	G	L	H	T	V	F	G	R	R	K	G	L	D	T	G	G	K	I	T	L	V	L	S	V	L	F	F	V	S	C	V	V	T	A	F	V

									10										20										30										40										50										60										70
E	T	F	S	K	I	R	V	K	P	E	H	V	I	G	V	T	V	A	F	V	I	I	E	A	I	L	T	Y	G	R	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	H	T	I	I	S	V	A	L	I	Y	M	V	Q	V	Q	M	S	K	F	S	E	L	G	G	A	F	G	S	G	G	L	H	T	V	F	G	R	R	K	G	L	D	T	G	G	K	I	T	L	V	L	S	V	L	F	F	V	S	C	V	V	T	A	F	V

									10										20										30										40										50										60										70
E	T	F	S	K	I	R	V	K	P	E	H	V	I	G	V	T	V	A	F	V	I	I	E	A	I	L	T	Y	G	R	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-
-	-	-	-	-	H	T	I	I	S	V	A	L	I	Y	M	V	Q	V	Q	M	S	K	F	S	E	L	G	G	A	F	G	S	G	G	L	H	T	V	F	G	R	R	K	G	L	D	T	G	G	K	I	T	L	V	L	S	V	L	F	F	V	S	C	V	V	T	A	F	V