PASS2.8 - Home

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x

beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x

hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x

                             10        20        30        40        50  
d2qlvb2  ( 306 )           ttdipavftdpsvmeryyytldrppqlpp-------------q
d2v8qb1  ( 190 )    gqemyaf---------------rseerfksppilpphllqvilnkdtnpn
                                                                      

                             60        70        80       
d2qlvb2  ( 375 )    hvvlnhlvtssikhntlcvasivrykqkyvtqilytpi
d2v8qb1  ( 235 )    hvmlnhlyalsikdsvmvlsathrykkkyvttllykpi
                           bb      bbbbbbbbbb  bbbbbbbbbb

Domains
Outliers

Domain ID	Name	Family	Source	Domain	STRING-DB
d2qlvb2 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2qlvb2 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	SIP2	AMPKBI-like	Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]		view
d2v8qb1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2v8qb1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	5'-AMP-activated protein kinase subunit beta-2	AMPKBI-like	Human (Homo sapiens) [TaxId: 9606]		view

No outliers

Feature	Download
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

									10										20										30										40										50										60										70										80
-	-	-	-	-	-	-	T	T	D	I	P	A	V	F	T	D	P	S	V	M	E	R	Y	Y	Y	T	L	D	R	P	P	Q	L	P	P	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	H	V	V	L	N	H	L	V	T	S	S	I	K	H	N	T	L	C	V	A	S	I	V	R	Y	K	Q	K	Y	V	T	Q	I	L	Y	T	P	I
G	Q	E	M	Y	A	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	S	E	E	R	F	K	S	P	P	I	L	P	P	H	L	L	Q	V	I	L	N	K	D	T	N	P	N	H	V	M	L	N	H	L	Y	A	L	S	I	K	D	S	V	M	V	L	S	A	T	H	R	Y	K	K	K	Y	V	T	T	L	L	Y	K	P	I

Member	Chain	UniProtKB	GO term

									10										20										30										40										50										60										70										80
-	-	-	-	-	-	-	T	T	D	I	P	A	V	F	T	D	P	S	V	M	E	R	Y	Y	Y	T	L	D	R	P	P	Q	L	P	P	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	H	V	V	L	N	H	L	V	T	S	S	I	K	H	N	T	L	C	V	A	S	I	V	R	Y	K	Q	K	Y	V	T	Q	I	L	Y	T	P	I
G	Q	E	M	Y	A	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	S	E	E	R	F	K	S	P	P	I	L	P	P	H	L	L	Q	V	I	L	N	K	D	T	N	P	N	H	V	M	L	N	H	L	Y	A	L	S	I	K	D	S	V	M	V	L	S	A	T	H	R	Y	K	K	K	Y	V	T	T	L	L	Y	K	P	I

									10										20										30										40										50										60										70										80
-	-	-	-	-	-	-	T	T	D	I	P	A	V	F	T	D	P	S	V	M	E	R	Y	Y	Y	T	L	D	R	P	P	Q	L	P	P	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	H	V	V	L	N	H	L	V	T	S	S	I	K	H	N	T	L	C	V	A	S	I	V	R	Y	K	Q	K	Y	V	T	Q	I	L	Y	T	P	I
G	Q	E	M	Y	A	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	S	E	E	R	F	K	S	P	P	I	L	P	P	H	L	L	Q	V	I	L	N	K	D	T	N	P	N	H	V	M	L	N	H	L	Y	A	L	S	I	K	D	S	V	M	V	L	S	A	T	H	R	Y	K	K	K	Y	V	T	T	L	L	Y	K	P	I

									10										20										30										40										50										60										70										80
-	-	-	-	-	-	-	T	T	D	I	P	A	V	F	T	D	P	S	V	M	E	R	Y	Y	Y	T	L	D	R	P	P	Q	L	P	P	-	-	-	-	-	-	-	-	-	-	-	-	-	Q	H	V	V	L	N	H	L	V	T	S	S	I	K	H	N	T	L	C	V	A	S	I	V	R	Y	K	Q	K	Y	V	T	Q	I	L	Y	T	P	I
G	Q	E	M	Y	A	F	-	-	-	-	-	-	-	-	-	-	-	-	-	-	-	R	S	E	E	R	F	K	S	P	P	I	L	P	P	H	L	L	Q	V	I	L	N	K	D	T	N	P	N	H	V	M	L	N	H	L	Y	A	L	S	I	K	D	S	V	M	V	L	S	A	T	H	R	Y	K	K	K	Y	V	T	T	L	L	Y	K	P	I