PASS2.8 - Home

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x

beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x

hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x

                             10        20        30        40        50  
d2ot2a1  (   1 )    mcigvPGqirtid--gnqAkvdvcgiqrdvdltlvgscDengqpRvgqwv
d2z1ca1  (   2 )     clavPGkVievn--gpvAvVdfggvk-eVrLdlmp------dTkpgdwV
d3d3ra1  (   2 )     clsipSqVvavdnerqsvtVdtlgvrrdvsshltepla------igdyv
                          bbbbbb     bbbbb       bb                 bb

                             60        70        80        90  
d2ot2a1  (  49 )    lvhvgfAmsvineaeArdtldalqnmfdvepdvgallygeek
d2z1ca1  (  43 )    ivhtgfAiekLdekkAmeileawaeveam             
d3d3ra1  (  46 )    lihigf-vnkidrndalqslelyqeivskle           
                                aaaaaaaaaaaaaa

Domains
Outliers

Domain ID	Name	Family	Source	STRING-DB
d2ot2a1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2ot2a1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Hydrogenase expression/formation protein HypC	HupF/HypC-like	Escherichia coli [TaxId: 562]	view
d2z1ca1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2z1ca1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Hydrogenase expression/formation protein HypC	HupF/HypC-like	Thermococcus kodakaraensis [TaxId: 311400]	view
d3d3ra1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d3d3ra1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Hydrogenase expression/formation protein HypC	HupF/HypC-like	Shewanella oneidensis [TaxId: 70863]	view

No outliers

Feature	Download
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

									10										20										30										40										50										60										70										80										90
M	C	I	G	V	P	G	Q	I	R	T	I	D	-	-	G	N	Q	A	K	V	D	V	C	G	I	Q	R	D	V	D	L	T	L	V	G	S	C	D	E	N	G	Q	P	R	V	G	Q	W	V	L	V	H	V	G	F	A	M	S	V	I	N	E	A	E	A	R	D	T	L	D	A	L	Q	N	M	F	D	V	E	P	D	V	G	A	L	L	Y	G	E	E	K
-	C	L	A	V	P	G	K	V	I	E	V	N	-	-	G	P	V	A	V	V	D	F	G	G	V	K	-	E	V	R	L	D	L	M	P	-	-	-	-	-	-	D	T	K	P	G	D	W	V	I	V	H	T	G	F	A	I	E	K	L	D	E	K	K	A	M	E	I	L	E	A	W	A	E	V	E	A	M	-	-	-	-	-	-	-	-	-	-	-	-	-
-	C	L	S	I	P	S	Q	V	V	A	V	D	N	E	R	Q	S	V	T	V	D	T	L	G	V	R	R	D	V	S	S	H	L	T	E	P	L	A	-	-	-	-	-	-	I	G	D	Y	V	L	I	H	I	G	F	-	V	N	K	I	D	R	N	D	A	L	Q	S	L	E	L	Y	Q	E	I	V	S	K	L	E	-	-	-	-	-	-	-	-	-	-	-

Member	Chain	UniProtKB	GO term
d2ot2a1	A	P0AAM3	GO:0005506
d2ot2a1	A	P0AAM3	GO:0005515
d2ot2a1	A	P0AAM3	GO:0042802
d2ot2a1	A	P0AAM3	GO:0051604
d2ot2a1	A	P0AAM3	GO:0065003
d2ot2a1	A	P0AAM3	GO:1902670
d2z1ca1	A	Q5JII0	GO:0005506
d2z1ca1	A	Q5JII0	GO:0005515
d2z1ca1	A	Q5JII0	GO:0051604
d2z1ca1	A	Q5JII0	GO:1902670
d3d3ra1	A	Q8EF93	GO:0005506
d3d3ra1	A	Q8EF93	GO:0051604
d3d3ra1	A	Q8EF93	GO:1902670

									10										20										30										40										50										60										70										80										90
M	C	I	G	V	P	G	Q	I	R	T	I	D	-	-	G	N	Q	A	K	V	D	V	C	G	I	Q	R	D	V	D	L	T	L	V	G	S	C	D	E	N	G	Q	P	R	V	G	Q	W	V	L	V	H	V	G	F	A	M	S	V	I	N	E	A	E	A	R	D	T	L	D	A	L	Q	N	M	F	D	V	E	P	D	V	G	A	L	L	Y	G	E	E	K
-	C	L	A	V	P	G	K	V	I	E	V	N	-	-	G	P	V	A	V	V	D	F	G	G	V	K	-	E	V	R	L	D	L	M	P	-	-	-	-	-	-	D	T	K	P	G	D	W	V	I	V	H	T	G	F	A	I	E	K	L	D	E	K	K	A	M	E	I	L	E	A	W	A	E	V	E	A	M	-	-	-	-	-	-	-	-	-	-	-	-	-
-	C	L	S	I	P	S	Q	V	V	A	V	D	N	E	R	Q	S	V	T	V	D	T	L	G	V	R	R	D	V	S	S	H	L	T	E	P	L	A	-	-	-	-	-	-	I	G	D	Y	V	L	I	H	I	G	F	-	V	N	K	I	D	R	N	D	A	L	Q	S	L	E	L	Y	Q	E	I	V	S	K	L	E	-	-	-	-	-	-	-	-	-	-	-

									10										20										30										40										50										60										70										80										90
M	C	I	G	V	P	G	Q	I	R	T	I	D	-	-	G	N	Q	A	K	V	D	V	C	G	I	Q	R	D	V	D	L	T	L	V	G	S	C	D	E	N	G	Q	P	R	V	G	Q	W	V	L	V	H	V	G	F	A	M	S	V	I	N	E	A	E	A	R	D	T	L	D	A	L	Q	N	M	F	D	V	E	P	D	V	G	A	L	L	Y	G	E	E	K
-	C	L	A	V	P	G	K	V	I	E	V	N	-	-	G	P	V	A	V	V	D	F	G	G	V	K	-	E	V	R	L	D	L	M	P	-	-	-	-	-	-	D	T	K	P	G	D	W	V	I	V	H	T	G	F	A	I	E	K	L	D	E	K	K	A	M	E	I	L	E	A	W	A	E	V	E	A	M	-	-	-	-	-	-	-	-	-	-	-	-	-
-	C	L	S	I	P	S	Q	V	V	A	V	D	N	E	R	Q	S	V	T	V	D	T	L	G	V	R	R	D	V	S	S	H	L	T	E	P	L	A	-	-	-	-	-	-	I	G	D	Y	V	L	I	H	I	G	F	-	V	N	K	I	D	R	N	D	A	L	Q	S	L	E	L	Y	Q	E	I	V	S	K	L	E	-	-	-	-	-	-	-	-	-	-	-

									10										20										30										40										50										60										70										80										90
M	C	I	G	V	P	G	Q	I	R	T	I	D	-	-	G	N	Q	A	K	V	D	V	C	G	I	Q	R	D	V	D	L	T	L	V	G	S	C	D	E	N	G	Q	P	R	V	G	Q	W	V	L	V	H	V	G	F	A	M	S	V	I	N	E	A	E	A	R	D	T	L	D	A	L	Q	N	M	F	D	V	E	P	D	V	G	A	L	L	Y	G	E	E	K
-	C	L	A	V	P	G	K	V	I	E	V	N	-	-	G	P	V	A	V	V	D	F	G	G	V	K	-	E	V	R	L	D	L	M	P	-	-	-	-	-	-	D	T	K	P	G	D	W	V	I	V	H	T	G	F	A	I	E	K	L	D	E	K	K	A	M	E	I	L	E	A	W	A	E	V	E	A	M	-	-	-	-	-	-	-	-	-	-	-	-	-
-	C	L	S	I	P	S	Q	V	V	A	V	D	N	E	R	Q	S	V	T	V	D	T	L	G	V	R	R	D	V	S	S	H	L	T	E	P	L	A	-	-	-	-	-	-	I	G	D	Y	V	L	I	H	I	G	F	-	V	N	K	I	D	R	N	D	A	L	Q	S	L	E	L	Y	Q	E	I	V	S	K	L	E	-	-	-	-	-	-	-	-	-	-	-