PASS2.8 - Home

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x

beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x

hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla
positive phi: italic x

                             10        20        30        40        50  
d2gboa1  (   2 )    degiskkfaiqlleddaeriklirnqknslcisqckafeevvdtqygfsr
d2odma-  (   5 )    a--tknaalkqLtkdAdeilhlIkvqldnl----cplyeevLdtqfglqk
                         aaaaaaaaaaaaaaa  aaaaa          aaaaaaa  aaaa

                             60        70        80  
d2gboa1  (  54 )    qVtyatrlgiltndeGhrllsdlerelnq    
d2odma-  (  55 )    evdfavklglVdredGkqil-rlekelsklhea
                    aaaaaaa     aaaaaa   aaaaaa

Domains
Outliers

Domain ID	Name	Family	Source	Domain	STRING-DB
d2gboa1 # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2gboa1 # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	Hypothetical protein EF2458	EF2458-like	Enterococcus faecalis [TaxId: 1351]		view
d2odma- # Domain Specific Files ATM file: Atomic coordinates by ASTRAL ATM2ALI file: Amino acid sequences by ATM2ALI SST file: Secondary structure by SSTRUC PSA file: solvent accessibility by PSA HBD file: Hydrogen bonds by HBOND PSE file: PyMol session file for conserved interactions PDBSUM1: Topological diagram d2odma- # Links to other databases and tools RCSB-PDB: Research Collaboratory for Structural Bioinformatics SCOP: Structural Classification of Proteins EBI: European Bioinformatics Institute HOMSTRAD: Homologous Structure Alignment Database DDBASE: Dial-Derived Domain Database CATH: Class Architecture Topology and Homologous sfily PALI: Phylogeny and ALIgnment of homologous protein structures MODBASE: A Database of Annotated Comparative Protein Structure Models 3Dee: A Database of Protein Domain Definition PQS: Protein Quaternary Structure Query Form at the EBI LPC/CSU: Ligand-Protein Contacts & Contacts of Structural LPFC: A Library of Protein Family Cores MMDB: Molecular Modelling DataBase,NCBI CE: Databases and Tools for 3-D Protein Structure Comparison and Alignment PDBSUM: Summaries and structural analyses of PDB data files Pfam: Protein families database of alignments and HMMs	automated matches	automated matches	Staphylococcus aureus [TaxId: 196620]		view

No outliers

Feature	Download
Superfamily
Distance Matrix
Conserved Interactions
Cusp Results
Alistat - Alignment Statistics
SMotif - Conserved Structural Motifs
MeanRMS
PCSSE Details
Absolutely Conserved Residues
Highly Conserved Residues

									10										20										30										40										50										60										70										80
D	E	G	I	S	K	K	F	A	I	Q	L	L	E	D	D	A	E	R	I	K	L	I	R	N	Q	K	N	S	L	C	I	S	Q	C	K	A	F	E	E	V	V	D	T	Q	Y	G	F	S	R	Q	V	T	Y	A	T	R	L	G	I	L	T	N	D	E	G	H	R	L	L	S	D	L	E	R	E	L	N	Q	-	-	-	-
A	-	-	T	K	N	A	A	L	K	Q	L	T	K	D	A	D	E	I	L	H	L	I	K	V	Q	L	D	N	L	-	-	-	-	C	P	L	Y	E	E	V	L	D	T	Q	F	G	L	Q	K	E	V	D	F	A	V	K	L	G	L	V	D	R	E	D	G	K	Q	I	L	-	R	L	E	K	E	L	S	K	L	H	E	A

Member	Chain	UniProtKB	GO term

									10										20										30										40										50										60										70										80
D	E	G	I	S	K	K	F	A	I	Q	L	L	E	D	D	A	E	R	I	K	L	I	R	N	Q	K	N	S	L	C	I	S	Q	C	K	A	F	E	E	V	V	D	T	Q	Y	G	F	S	R	Q	V	T	Y	A	T	R	L	G	I	L	T	N	D	E	G	H	R	L	L	S	D	L	E	R	E	L	N	Q	-	-	-	-
A	-	-	T	K	N	A	A	L	K	Q	L	T	K	D	A	D	E	I	L	H	L	I	K	V	Q	L	D	N	L	-	-	-	-	C	P	L	Y	E	E	V	L	D	T	Q	F	G	L	Q	K	E	V	D	F	A	V	K	L	G	L	V	D	R	E	D	G	K	Q	I	L	-	R	L	E	K	E	L	S	K	L	H	E	A

									10										20										30										40										50										60										70										80
D	E	G	I	S	K	K	F	A	I	Q	L	L	E	D	D	A	E	R	I	K	L	I	R	N	Q	K	N	S	L	C	I	S	Q	C	K	A	F	E	E	V	V	D	T	Q	Y	G	F	S	R	Q	V	T	Y	A	T	R	L	G	I	L	T	N	D	E	G	H	R	L	L	S	D	L	E	R	E	L	N	Q	-	-	-	-
A	-	-	T	K	N	A	A	L	K	Q	L	T	K	D	A	D	E	I	L	H	L	I	K	V	Q	L	D	N	L	-	-	-	-	C	P	L	Y	E	E	V	L	D	T	Q	F	G	L	Q	K	E	V	D	F	A	V	K	L	G	L	V	D	R	E	D	G	K	Q	I	L	-	R	L	E	K	E	L	S	K	L	H	E	A

									10										20										30										40										50										60										70										80
D	E	G	I	S	K	K	F	A	I	Q	L	L	E	D	D	A	E	R	I	K	L	I	R	N	Q	K	N	S	L	C	I	S	Q	C	K	A	F	E	E	V	V	D	T	Q	Y	G	F	S	R	Q	V	T	Y	A	T	R	L	G	I	L	T	N	D	E	G	H	R	L	L	S	D	L	E	R	E	L	N	Q	-	-	-	-
A	-	-	T	K	N	A	A	L	K	Q	L	T	K	D	A	D	E	I	L	H	L	I	K	V	Q	L	D	N	L	-	-	-	-	C	P	L	Y	E	E	V	L	D	T	Q	F	G	L	Q	K	E	V	D	F	A	V	K	L	G	L	V	D	R	E	D	G	K	Q	I	L	-	R	L	E	K	E	L	S	K	L	H	E	A