PURE [Prediction of Unassigned REgions] Server:

PURE - Prediction of Unassigned REgions is a method to identify putative domains in the Unassigned Regions[URs]. PURE is now available as a web server. Users can submit the sequence of unassigned regions / Linker regions to predict domains encoded in them.

---

FASTA format description

A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column. It is recommended that all lines of text be shorter than 80 characters in length. An example sequence in FASTA
format is:

>NP_852891.1.1-130
MCITLHEAQFFKRLKKTYMVQTIGRRKTQSFEYLKNKWGSSNKSAIEVIQITMDNIENSL
LFKDLRTLVYTSNIVENYNSVIGTFLPAKKSFNNINQFLLDLYVHFGNNPRYKKLNQKTR
RVRNWYRIYE

Sequences are expected to be represented in the standard IUB/IUPAC amino acid with these exceptions: lower-case letters are accepted and are mapped into upper-case; a single hyphen or dash can be used to represent a gap of indeterminate length; and in amino acid sequences, are acceptable letters (see below). Before submitting a request, any numerical digits in the query sequence should either be removed or replaced by appropriate letter codes (e.g., X for unknown amino acid residue).
For those programs that use amino acid query sequences (BLASTP ,BLASTPGP), the accepted amino acid codes are:

    A  alanine                         P  proline
    B  aspartate or asparagine         Q  glutamine
    C  cystine                         R  arginine
    D  aspartate                       S  serine
    E  glutamate                       T  threonine
    F  phenylalanine                   U  selenocysteine
    G  glycine                         V  valine
    H  histidine                       W  tryptophan
    I  isoleucine                      Y  tyrosine
    K  lysine                          Z  glutamate or glutamine
    L  leucine                         X  any
    M  methionine                      
    N  asparagine                      

---

Contact:
Prof. R. Sowdhamini (mini@ncbs.res.in)
Dr. Bernard Offman
Chilamakuri Chandra Sekhar Reddy
K. Shameer