PASS2
  • Superfamily Details
  • Alignment & HMM

Superfamily Details

Superfamily summary
Superfamily Name:  Mitochondrial cytochrome c oxidase subunit VIIb
Class Name:  Membrane and cell surface proteins and peptides
Fold Name:  Single transmembrane helix
Number of Members:  1
Average Size: 
Members
SCOP ID Name Source
d1v54k- Mitochondrial cytochrome c oxidase subunit VIIb Cow (Bos taurus) [TaxId: 9913]

Alignment Based On Similarities In Structural Features using Comparer

                             10        20        30        40        
d1v54k-  (   6 )    apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
                       aaaaaaaaaaaaaaaaaaaaaaaaaaa                   

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x
beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x
hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla ç
positive phi: italic x