PASS2
  • Superfamily Details
  • Alignment & HMM
  • Jmol View
  • Tree View
  • Features

Superfamily Details

Superfamily summary
Superfamily Name:  Enolase C-terminal domain-like
Class Name:  Alpha and beta proteins (a/b)
Fold Name:  TIM beta/alpha-barrel
Number of Members:  14
Average Size: 
Members
SCOP ID Name Source
d2akza1 Enolase Human (Homo sapiens), gamma isoform [TaxId: 9606]
d1jdfa1 D-glucarate dehydratase Escherichia coli [TaxId: 562]
d1r6wa1 O-succinylbenzoate synthase Escherichia coli [TaxId: 562]
d1muca1 Muconate-lactonizing enzyme Pseudomonas putida [TaxId: 303]
d2mnra1 Mandelate racemase Pseudomonas putida [TaxId: 303]
d1jpdx1 L-Ala-D/L-Glu epimerase Escherichia coli [TaxId: 562]
d1jpma1 L-Ala-D/L-Glu epimerase Bacillus subtilis [TaxId: 1423]
d1kkoa1 beta-Methylaspartase Citrobacter amalonaticus [TaxId: 35703]
d1rvka1 Hypothetical protein Atu3453 Agrobacterium tumefaciens [TaxId: 358]
d1r0ma1 N-acylamino acid racemase Deinococcus radiodurans [TaxId: 1299]
d1tzza1 Hypothetical protein Bll6730 Bradyrhizobium japonicum [TaxId: 375]
d1yeya1 RTS beta protein Xanthomonas campestris pv. campestris [TaxId: 340]
d2gdqa1 Hypothetical protein YitF Bacillus subtilis [TaxId: 1423]
d2gl5a1 Putative dehydratase protein STM2273 Salmonella typhimurium [TaxId: 90371]

Alignment Based On Similarities In Structural Features using Comparer

                             10        20        30        40        50  
d1jdfa1  ( 138 )    dgqqrseVeMLGYL-fFvgnrkaTplpyqsqpddscdWyrlRheeAmtpd
d1jpdx1  ( 114 )      tlpetViTAqTV-vig-----------------------------tpd
d1jpma1  ( 126 )       yrdtLeTDytV-svn-----------------------------spe
d1kkoa1  ( 161 )     pcvpeaiplFGqSg----------------------------------d
d1muca1  ( 131 )      rvrdsLeVAwtL-asg-----------------------------dta
d1r0ma1  ( 133 )       hkeqVeVGVsL-giqa----------------------------deq
d1r6wa1  ( 100 )       qAanyraAplC-n------------------------------gdpd
d1rvka1  ( 127 )       yrdkVlAYGSI-cGdele----------------------gGLatpe
d1tzza1  (1146 )      kanprVfVYAAG-Gyy-----------------------------gls
d1yeya1  ( 184 )          gypAYTTs-PGwd------------------------------e
d2akza1  ( 140 )     s-dlILPVPAFNVI---NGGshAgnkLAMqEFMILPVgAe------sFr
d2gdqa1  ( 119 )      ryreeIpVYASF-qSysdsp------------------------qwis
d2gl5a1  ( 123 )      ktnekLrTYASq-LQfGWgd-------------------knhiLvtpe
d2mnra1  ( 133 )          pvqAYdSH-s-----------------------------ldgvk
                           bb  bb                                   aa

                             60        70        80        90        100 
d1jdfa1  ( 187 )    aVvrLAeAAyekYgFndFKLkGgvl-----------------------aG
d1jpdx1  ( 132 )    qMansAstlwqag-AkLLkVkLdnh-------------------------
d1jpma1  ( 143 )    eMAadAenylkqg-fqTLkIkVGkd-----------------------di
d1kkoa1  ( 176 )    dryiaVdkIl------------------kgvdVLPhAlInnveekLGfkG
d1muca1  ( 149 )    rDiaeArhmleirrHrvFkLkIGan-----------------------pv
d1r0ma1  ( 151 )    aTvdlVrrhveq-gyrRIkLkIk--------------------------p
d1r6wa1  ( 116 )    dlilkLadmp---gekvAkvrVGly-----------------------eA
d1rvka1  ( 152 )    dYgrfAetLvkrg-YkGIKLhTWp-------------------pvswApd
d1tzza1  (1168 )    mlrgeMrgyLdrg-YnVVkMkIGg-----------------------api
d1yeya1  ( 201 )    kLvrlAkeavadg-frtiKLkVGa------------------------nv
d2akza1  ( 179 )    dAmrLGaeVYhtLkg------vIkdkygkdAtnvgdEGGFaPnil-----
d2gdqa1  ( 142 )    rsvsnVeaqlkkg-FeqIKVkIGgt-----------------------sf
d2gl5a1  ( 151 )    eYAeAAraAlddg-YdAIKVDPLEIdrngddCvfqnrnrnYsglLladql
d2mnra1  ( 147 )    lAterAvtAaelg-FrAVKTkIG--yp---------------------al
                    aaaaaaaaaaa     bbbbb                             

                             110       120       130       140       150 
d1jdfa1  ( 214 )    eeEAeSIvaLaqrfp--------qArITLDPngaWs--------------
d1jpdx1  ( 156 )    -lIserMvaIrtaVp--------dAtLIVdAnesWr--------------
d1jpma1  ( 169 )    atDiarIqeIrkrVgs-------aVkLrLdAnqgWr--------------
d1kkoa1  ( 209 )    ekLreYVrwLSdrIlslrsspryhPtLHIDVyGTIglifd----------
d1muca1  ( 176 )    eqDLkhVvtIkreLgd-------sAsVrVDVnqyWd--------------
d1r0ma1  ( 174 )    gwDvqPVraTreafp--------dirLTVdAnsaYt--------------
d1r6wa1  ( 140 )    vrDGmvVnlLLeaIp--------dLhLRLdAnraWt--------------
d1rvka1  ( 183 )    vkDlkACaaVreaVgp-------dirLI-DAfhwYs--------------
d1tzza1  (1194 )    eeDrmrIeaVleeIgk-------dAqLAVdAngrFn--------------
d1yeya1  ( 226 )    qdDirrCrlaraaIgp-------dIa-AVDAnqrwd--------------
d2akza1  ( 218 )    -eNseALeLVkeAIdka-gyte-kIvIGMDVaASeF-yrdgkYDldfksp
d2gdqa1  ( 168 )    keDvrHInaLqhtAgs-------sitMILDAnqsyd--------------
d2gl5a1  ( 200 )    kMGeaRIaaMreAMgd-------dadIIVEIhSlLg--------------
d2mnra1  ( 173 )    dqDlaVVrsIrqaVgd-------dfgIMVDYnqsld--------------
                    aaaaaaaaaaaaaa           bbbbb                    

                             160       170       180       190       200 
d1jdfa1  ( 242 )    --------lneAikigkyL-kg---sLaYAEDPCgaeqgfsgreVMaeFr
d1jpdx1  ( 183 )    --------aegLaarCqlL-adl--gVaMLEQPLpa----qdDaaLenf-
d1jpma1  ( 198 )    --------pkeAvtAIrkM-edagLgIeLVEQPVhk----ddlagLkkVt
d1kkoa1  ( 250 )    -------dpvrCAeYIasLekeAqgLpLyIEGPvda-gnkpdQirLtaIt
d1muca1  ( 205 )    --------esqAirACqvL-Gdn--gIdLIEQPIsr----inrgGQvrLn
d1r0ma1  ( 202 )    --------lad-agrLrqL-dey--dLtYIEQPLa----wddlvdHAeLa
d1r6wa1  ( 168 )    --------plkGqqFAkyVnpdyrdrIaFLEEPCk------trddSraFA
d1rvka1  ( 213 )    --------rtdalaLGrgL-eklg--FdwIEEP-dE----qslssYkwLS
d1tzza1  (1223 )    --------letGiaYAkML-rdyp--LfWYEEVGdp----ldyalqaaLa
d1yeya1  ( 255 )    --------vgpAidw-rql-aeFd--IaWiEEPTsp----ddvlgHaaIr
d2akza1  ( 264 )    tdpsrYitgdqLgalYqdFvrdy--pVvSIEDPFDq----ddwaaWskFt
d2gdqa1  ( 197 )    --------aaaAfkWeryF-sewtn-IgWLEEPLpf----dqpqdYamLr
d2gl5a1  ( 229 )    --------tnSAiqFAkaI-ekyr--IfLYEEPIhP----lnsdnMqkVs
d2mnra1  ( 202 )    --------vpaAikrSqaL-qqeg--VtWIEEPTlq----hdyeGHqrIq
                            aaaaaaaaaa           bb           aaaaaaaa

                             210       220       230       240       250 
d1jdfa1  ( 280 )    raT-----gLpTATnmiA-tdwrqMghTlslqSVd----IPLADPhfW-t
d1jpdx1  ( 217 )    -iH-----pLpICAdesC-htrsnLkaLk--grYe----MVNIkldkTgg
d1jpma1  ( 235 )    daT-----dtpIMADeSV-ftprqAfeVLqtrSAd----lINIklmKAgg
d1kkoa1  ( 293 )    keLtrlgsgVkIVAdewCn-tyqdIvdFtdagSCh-----VQIkTpdLgg
d1muca1  ( 240 )    qrT-----pApIMADeSI-esvedAfsLAadgAAs----IFALkiakNgg
d1r0ma1  ( 236 )    rrI-----rTpLCLdeSV-asasdArkALalgAGg----vINLkvarVgg
d1r6wa1  ( 204 )    ret-----gIaIAWDeSL-repdFa--fvaeegVr----AVVIkptlTgs
d1rvka1  ( 248 )    dnL-----dIpVVGPesaagkhwhRaeWikagACd----iLRTGvndVgg
d1tzza1  (1258 )    efY-----pgpMAtGenL-fshqdArnLLryGgMrpdrDwLQFDCalsyg
d1yeya1  ( 290 )    qgit----pvpVSTGehT-qnrvvFkqLLqagAVd----LIQIdAarVgg
d2akza1  ( 308 )    a-----nvgiQIVGDdLTvTnpkrIerAveekACn----CLLLkvnqigs
d2gdqa1  ( 233 )    srL-----svpVAGGenm-kgpaqYvpLLsqrCLd----IIQPdvmhVng
d2gl5a1  ( 264 )    rsT-----tIpIATGers-ytrwgYreLLekqSIa----VAQPdLclCgg
d2mnra1  ( 237 )    skL-----nvpVQMGenW-lgpeeMfkALsigACr----lAMPDAmkIgg
                    a          bbb       aaaaaaaaa         bb         

                             260       270       280       290       300 
d1jdfa1  ( 319 )    mqgSvrVAqmChefglt---WGShSd-nhfDisLAmFThVAAaAp-----
d1jpdx1  ( 254 )    lteAlaLAteAraqgFs---LMLGcm-lctSraIsaAlpLvpq-------
d1jpma1  ( 275 )    isgAekINamAeacgve---CMVGsm-ietklgITaAAhFAAskr-----
d1kkoa1  ( 338 )    ihnIvdAVlyCnkhg-e---AYQGGtcneteisArtcvhvalaA------
d1muca1  ( 280 )    praVlrTAqiAeaagig---LYGGTm-legSigTLaSAhAFLtlr-----
d1r0ma1  ( 276 )    haeSrrVHdvAqsfgap---VWCGgm-lesGigRAhNIhLst-ls-----
d1r6wa1  ( 242 )    lekVreqVqaAhalgLt---AVIsSs-iesSlgLTqLAriAawlT-----
d1rvka1  ( 289 )    itpAlkTh-lAeafg----ecEVhgn-------tA-nLhVVaat------
d1tzza1  (1302 )    lceYqrTlevLkthgWspsrCIPhgG-------hQmSLnIAagl------
d1yeya1  ( 331 )    vneNlaILllAakfgvr---VFPhAg-g-v-GlCElVQhLAaDfvaitgk
d2akza1  ( 349 )    vteAiqACklAqengWG---VMVSHrsgeted--tfiAdlVVgl------
d2gdqa1  ( 273 )    ideFrdCLqlAryfgvr---ASAhay-d-gSlsRLyALfAQAcLppwskm
d2gl5a1  ( 304 )    iteGkkICdyAniydTt---VQVhVc-g-gpvstVaALhMEtaIp-----
d2mnra1  ( 277 )    vtgWirAsalAqqfgip---MSShl-------fQeiSAhlLaaTp-----
                    aaaaaaaaaaaaa       b           aaaaaaaaa         

                             310       320       330       340       350 
d1jdfa1  ( 360 )    --gkITAIDThWIwqegn------qrlTkepfeIkgGlVqVpekp-glgv
d1jpdx1  ( 293 )    ---Vs-fAdLdgPtwl-a------vd-vepalqfttGeLhl         
d1jpma1  ( 316 )    --nIt-rfdFdaplml-k------tdvfngGItysgstIsmpgkp-glGi
d1kkoa1  ( 379 )    --rPrLIKpggfd-eGlnivfne-n---------------rtiallqt  
d1muca1  ( 321 )    --qLtwgTELFGPlll-t------eeiVneppqYrdfqLhIprtp-glgl
d1r0ma1  ( 316 )    --NFrlPgdTSsasrywe------rdlIqepLeAvdGlMpvpqgp-gtgV
d1r6wa1  ( 283 )    --p-dtiPgLdtldlm-q------aQqv-rrwp-------------gstl
d1rvka1  ( 323 )    --knCrWYERGlLhpfleyddghdylkslsDpd-rdgfVhvpdrp-----
d1tzza1  (1339 )    --g-LgGNEsy---Pdlf----qpyggfPdgvrVenGhItmpdlp-----
d1yeya1  ( 377 )    ---edRAIEfVdh--------lhqhfldp--VriqhGrYlapevp-----
d2akza1  ( 388 )    --cTGQIKTGAPcrseRlaKYnqLm---------------rieeelgdea
d2gdqa1  ( 318 )    kndhiEpIEWDvm-----enpftdlV--s--lqPskgmVhIpkgk-----
d2gl5a1  ( 344 )    ---nfiIHEHhTnam---kasirelCthd--yqPengyYvaPeqp-----
d2mnra1  ( 312 )    ---tahwLErldla--------gsviept--LtfegGnAvipdlp-----
                                                         bb           

                             360       370       380       390       400 
d1jdfa1  ( 401 )    -eidmdqvmkahelyqkhglgarddamgmqylipgwtfdnkrpcmvr   
d1jpdx1                                                               
d1jpma1  ( 355 )    igaal                                             
d1kkoa1                                                               
d1muca1  ( 361 )    -tldeqrlarfar                                     
d1r0ma1  ( 357 )    -tldreflatvte----------------------------------aqe
d1r6wa1  ( 309 )    pvvevdalerl---------------------------------------
d1rvka1  ( 366 )    ----------------glgedid---ftfidnnrv               
d1tzza1  (1374 )    ----------------giGfegksdLykemkalae               
d1yeya1  ( 409 )    ----------------gfsae-h---pasiaefsypdGrfwvedla    
d2akza1  ( 421 )    rFAghnfrnpsvl                                     
d2gdqa1  ( 354 )    ----------------gigtein---meivnrykwdgsa------y    
d2gl5a1  ( 381 )    ----------------glgQeln---devvkeylayvik           
d2mnra1  ( 344 )    ----------------gvgiiwr---ekeigkyl----v           
                                                                      

                        
d1jdfa1                 
d1jpdx1                 
d1jpma1                 
d1kkoa1                 
d1muca1                 
d1r0ma1  ( 372 )    ehra
d1r6wa1  ( 320 )    ---l
d1rvka1                 
d1tzza1                 
d1yeya1                 
d2akza1                 
d2gdqa1                 
d2gl5a1                 
d2mnra1                 
                        

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x
beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x
hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla ç
positive phi: italic x

Jmol view

Jmol Model View
Jmol Command prompt
Response Logs

Tree based on RMSD between structures

Matrices

1. Percentage Identity Matrix  [View | Download]
2. Distance Matrix  [View | Download]

PCA based on sequence identity

1. PCA  [View]
2. Plot file  [Download]

CUSP Results

CUSP Result   [View | Download]

Alistat - Alignment Statistics

Alignment Statistics  [Download]

SMotif - Conserved Structural Motifs

SMotif Result   [View | Download]

MeanRMS

MeanRMS  [Download]