PASS2
  • Superfamily Details
  • Alignment & HMM
  • Jmol View
  • Tree View
  • Features

Superfamily Details

Superfamily summary
Superfamily Name:  Aldolase
Class Name:  Alpha and beta proteins (a/b)
Fold Name:  TIM beta/alpha-barrel
Number of Members:  37
Average Size: 
Members
SCOP ID Name Source
d1p1xa- Deoxyribose-phosphate aldolase DeoC Escherichia coli [TaxId: 562]
d1ub3a- Deoxyribose-phosphate aldolase DeoC Thermus thermophilus [TaxId: 274]
d1n7ka- Deoxyribose-phosphate aldolase DeoC Archaeon Aeropyrum pernix [TaxId: 56636]
d1vcva1 Deoxyribose-phosphate aldolase DeoC Archaeon Pyrobaculum aerophilum [TaxId: 13773]
d1ojxa- Archaeal fructose 1,6-bisphosphate aldolase Archaeon Thermoproteus tenax [TaxId: 2271]
d1hl2a- N-acetylneuraminate lyase Escherichia coli [TaxId: 562]
d1f74a- N-acetylneuraminate lyase Haemophilus influenzae [TaxId: 727]
d1o5ka- Dihydrodipicolinate synthase Thermotoga maritima [TaxId: 2336]
d1xxxa1 Dihydrodipicolinate synthase Mycobacterium tuberculosis [TaxId: 1773]
d1xkya1 Dihydrodipicolinate synthase Bacillus anthracis [TaxId: 1392]
d2qapa1 Fructose-1,6-bisphosphate aldolase Trypanosome (Leishmania mexicana) [TaxId: 5665]
d2a4aa1 Fructose-1,6-bisphosphate aldolase Plasmodium yoelii yoelii [TaxId: 73239]
d1wbha1 KDPG aldolase Escherichia coli [TaxId: 562]
d1wa3a1 KDPG aldolase Thermotoga maritima [TaxId: 2336]
d1vhca- Hypothetical protein HI0047 Haemophilus influenzae [TaxId: 727]
d1gqna- Type I 3-dehydroquinate dehydratase Salmonella typhi [TaxId: 90370]
d1sfla- Type I 3-dehydroquinate dehydratase Staphylococcus aureus [TaxId: 1280]
d1onra- Transaldolase Escherichia coli [TaxId: 562]
d1l6wa- Decameric fructose-6-phosphate aldolase/transaldolase Escherichia coli [TaxId: 562]
d1wx0a1 Decameric fructose-6-phosphate aldolase/transaldolase Thermus thermophilus [TaxId: 274]
d1to3a- Putative aldolase YihT Salmonella typhimurium [TaxId: 90371]
d1w3ia- 2-keto-3-deoxy gluconate aldolase Eda Sulfolobus solfataricus [TaxId: 2287]
d1dosa- Fructose-bisphosphate aldolase (FBP aldolase) Escherichia coli [TaxId: 562]
d1gvfa- Tagatose-1,6-bisphosphate aldolase Escherichia coli [TaxId: 562]
d1h7na- 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
d1gzga- 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) Pseudomonas aeruginosa [TaxId: 287]
d1l6sa- 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) Escherichia coli [TaxId: 562]
d1of8a- 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId: 4932]
d1vr6a1 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) Thermotoga maritima [TaxId: 2336]
d2a21a1 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8P synthase) Aquifex aeolicus [TaxId: 63363]
d1nvma2 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain Pseudomonas sp. [TaxId: 306]
d1sr9a2 2-isopropylmalate synthase LeuA, catalytic domain Mycobacterium tuberculosis [TaxId: 1773]
d1rqba2 Transcarboxylase 5S subunit, N-terminal domain Propionibacterium freudenreichii shermanii [TaxId: 1752]
d1vlia2 Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain Bacillus subtilis [TaxId: 1423]
d2zdra2 Capsule biosynthesis protein SiaC, N-terminal domain Neisseria meningitidis [TaxId: 487]
d2fiqa1 Putative tagatose 6-phosphate kinase 1 GatZ Escherichia coli [TaxId: 562]
d2b7oa1 Probable DAHP synthetase AroG, phenylalanine-repressible Mycobacterium tuberculosis [TaxId: 1773]

Alignment Based On Similarities In Structural Features using Comparer

                             10        20        30        40        50  
d1dosa-  (   1 )                                                      
d1f74a-  (   1 )                                                      
d1gqna-  (   1 )                                                      
d1gvfa-  (   2 )                                                      
d1gzga-  (   7 )                                                      
d1h7na-  (   1 )                                                      
d1hl2a-  (   3 )                                                      
d1l6sa-  (   1 )                                                      
d1l6wa-  (   1 )                                                      
d1n7ka-  (   2 )                                                      
d1nvma2  (   2 )                                                      
d1o5ka-  (   0 )                                                      
d1of8a-  (  23 )                                      vrilgyd---------
d1ojxa-  (   3 )                                                      
d1onra-  (   2 )                                                      
d1p1xa-  (   1 )                                                      
d1rqba2  (   4 )                                                      
d1sfla-  (   3 )                                                      
d1sr9a2  (  61 )                                                      
d1to3a-  (   1 )                                                      
d1ub3a-  (   2 )                                                      
d1vcva1  (   1 )                                                      
d1vhca-  (   2 )                                                      
d1vlia2  (   2 )                                                      
d1vr6a1  (   1 )    miVvLkpgsteedirkVvklAesynlkChiskgqe------rtvIgIigd
d1w3ia-  (   2 )                                                      
d1wa3a1  (   2 )                                                      
d1wbha1  (   1 )                                                      
d1wx0a1  (   1 )                                                      
d1xkya1  (   1 )                                                      
d1xxxa1  (   5 )                                                      
d2a21a1  (1002 )                                                      
d2a4aa1  (   3 )                                                      
d2b7oa1  (   2 )                                      nwtvdipidqlpslpp
d2fiqa1  (   2 )                                                      
d2qapa1  (   1 )                                                      
d2zdra2  (   2 )                                                      
                                                                      

                             60        70        80        90        100 
d1dosa-  (   1 )                                                      
d1f74a-  (   1 )                                                      
d1gqna-  (   1 )                                                      
d1gvfa-  (   2 )                                                      
d1gzga-  (   7 )                                                      
d1h7na-  (   1 )                                                      
d1hl2a-  (   3 )                                                      
d1l6sa-  (   1 )                                                      
d1l6wa-  (   1 )                                                      
d1n7ka-  (   2 )                                                      
d1nvma2  (   2 )                                                      
d1o5ka-  (   0 )                                                      
d1of8a-  (  30 )    --------------------------plasPalLqvqipAtptSleTAkr
d1ojxa-  (   3 )                                                      
d1onra-  (   2 )                                                      
d1p1xa-  (   1 )                                                      
d1rqba2  (   4 )                                                      
d1sfla-  (   3 )                                                      
d1sr9a2  (  61 )                                                      
d1to3a-  (   1 )                                                      
d1ub3a-  (   2 )                                                      
d1vcva1  (   1 )                                                      
d1vhca-  (   2 )                                                      
d1vlia2  (   2 )                                        aafqIa--------
d1vr6a1  (  45 )    dryvvadkFesldcVesVvrvlkpYklVSrefhpedtvIdlg--------
d1w3ia-  (   2 )                                                      
d1wa3a1  (   2 )                                                      
d1wbha1  (   1 )                                                      
d1wx0a1  (   1 )                                                      
d1xkya1  (   1 )                                                      
d1xxxa1  (   5 )                                                      
d2a21a1  (1002 )                                                      
d2a4aa1  (   3 )                                                      
d2b7oa1  (  18 )    lptdlrtrldaaLakpaaqqPtWpadqalartvLesvppvT--vpseIvr
d2fiqa1  (   2 )                                                      
d2qapa1  (   1 )                                                      
d2zdra2  (   2 )                                     qnnnefkIg--------
                                                                      

                             110       120       130       140       150 
d1dosa-  (   1 )                                                      
d1f74a-  (   1 )                                                      
d1gqna-  (   1 )                                                      
d1gvfa-  (   2 )                                                      
d1gzga-  (   7 )                   n--------raypy-trlrrnrrddfsrrlvren-
d1h7na-  (   1 )                   mhtaefletepteissvlaggynhpllrqwqser-
d1hl2a-  (   3 )                                                      
d1l6sa-  (   1 )                             tdli-qrprrlrkspalramfeet-
d1l6wa-  (   1 )                                                      
d1n7ka-  (   2 )                                     psardilqqGldrLgsp
d1nvma2  (   2 )                                                      
d1o5ka-  (   0 )                                                      
d1of8a-  (  54 )    GrreAidIIt---gkddrVLVIVGPCSIh-dl-eaAqeYAlrLkkLsdel
d1ojxa-  (   3 )                                                      
d1onra-  (   2 )                                                      
d1p1xa-  (   1 )                                       mtdlkasSl------
d1rqba2  (   4 )                                                      
d1sfla-  (   3 )                                                      
d1sr9a2  (  61 )                                                      
d1to3a-  (   1 )                                                      
d1ub3a-  (   2 )                                                      
d1vcva1  (   1 )                                                      
d1vhca-  (   2 )                                                      
d1vlia2  (   8 )    ---------nktVGkdapVFIIAeAgiNhdgkldqAfaLIdAAaeA----
d1vr6a1  (  87 )    ---------dVkIGng-yFTIIAGPcSVe--gremLmeTAhfLsel----
d1w3ia-  (   2 )                                                      
d1wa3a1  (   2 )                                                      
d1wbha1  (   1 )                                                      
d1wx0a1  (   1 )                                                      
d1xkya1  (   1 )                                                      
d1xxxa1  (   5 )                                                      
d2a21a1  (1002 )                   e-kFLVIAGPCAIe--seelLlkVGeeIkrLse--
d2a4aa1  (   3 )                                       nytekfaAw------
d2b7oa1  (  67 )    LqeqLaqVAk---g--eaFLlqGgdcAEtFdntephIrgNVrALLqavVL
d2fiqa1  (   2 )                                                      
d2qapa1  (   1 )                                                      
d2zdra2  (  11 )    ---------nrsVGynhePLIICEIGINHegslktAfeMVdaAynA----
                                                                      

                             160       170       180       190       200 
d1dosa-  (   1 )                               skIfdfVkpgVITgddVqkVFqV
d1f74a-  (   1 )                                                      
d1gqna-  (   1 )                                                      
d1gvfa-  (   2 )                                        sIis---TkylLqd
d1gzga-  (  32 )    vLtvddLIlPVFVld--gvnqr-esIp----sMpgverLSidqLlieAee
d1h7na-  (  35 )    qLtknmLIFPLFISd--npddf-teId----sLpnInrIGvnrLkdyLkp
d1hl2a-  (   3 )                                                      
d1l6sa-  (  24 )    tlsLndLVlPIFVEE--eiddy-kaVe----aMpgvmriPekhLareIer
d1l6wa-  (   1 )                                   melYLdtSdvvaVkalsri
d1n7ka-  (  19 )    edLasrIDStllsp-----------------------rAteedVrnlVre
d1nvma2  (   2 )                           t--fnp---skkLyISDVTLRDGShai
d1o5ka-  (   0 )                                                      
d1of8a-  (  99 )    kg---dLSIIMRA--YLekp-rtt-------vgwkGLInDPdvnn-----
d1ojxa-  (   3 )                                             nltekFlri
d1onra-  (   2 )                tdk--LtSLr-q--y----TtVVAdtGdiaAMkly---
d1p1xa-  (  10 )    -rALklMDLttLnd-----------------------dDtdekVialChq
d1rqba2  (   4 )                           r--eievsepreVgITELvlRDahqsl
d1sfla-  (   3 )                                                      
d1sr9a2  (  61 )                           rtwpdrvid-rAPlWCAVdlrDGnqaL
d1to3a-  (   1 )                                              lnnytikd
d1ub3a-  (   2 )     dlaahIDHtllkp-----------------------tAtleeVakAAee
d1vcva1  (   1 )      mIhLVDYalLkp-----------------------yltvdeAvaGArk
d1vhca-  (   2 )                                         syttqqIIekLre
d1vlia2  (  45 )    ------gAdAVKF--q-fqadryqkdp-------------dvsifslv--
d1vr6a1  ( 121 )    ------gVkVLrG--gAykp-rtsp----------------------ysf
d1w3ia-  (   2 )                                                      
d1wa3a1  (   2 )                                              kMeelFkk
d1wbha1  (   1 )                                        mknwktsaesILtt
d1wx0a1  (   1 )                                   melYLdtAsleeIreIaaw
d1xkya1  (   1 )                                                      
d1xxxa1  (   5 )                                                      
d2a21a1  (1032 )    --kFkeVeFVFKS--SFdkanrssi----------------------hSf
d2a4aa1  (  12 )    -sVIclTDHtflde-----------------------ngteddIreLCne
d2b7oa1  ( 114 )    tyGaspVvkVaRIAGQYakp-rsadidalglrSYrGdINgfapdaaaReH
d2fiqa1  (   2 )                                                ktliar
d2qapa1  (   1 )             msrvtv--lqsq---lpa----ynrlkTp-yeseLiaTVkk
d2zdra2  (  48 )    ------gAeVVKH--qTHiVedemsdeakqv----ipgnadvsiyeImer
                                                                      

                             210       220       230       240       250 
d1dosa-  (  24 )    A--ke-nn-FALPAVnCvgtdsInAVLeTAakvkAPVIVqFsnggAsfia
d1f74a-  (   1 )                                                      
d1gqna-  (   1 )                                                      
d1gvfa-  (  13 )    A--qa-ng-YAVPAFnIhnaetIqAILeVCsemrSPVILAGtpgtFk---
d1gzga-  (  75 )    w--valgIpaLALFPvTp-----------vekKsld------AaeAynp-
d1h7na-  (  78 )    l--vakgLrsVILFGVPl----------ipgtkdpv------GtaAddp-
d1hl2a-  (   3 )                                                      
d1l6sa-  (  67 )    I--anagIrsVMTFGiSh-------------htdet------GsDAwre-
d1l6wa-  (  20 )    f-----pLaGVTTn--psiiaagk--------------------------
d1n7ka-  (  46 )    A--sdygFrCAVLt------------------------------------
d1nvma2  (  24 )    r--------------HqYtlddVraIAr-aLdkAkVdSIEVAHGdGLqGs
d1o5ka-  (   0 )                                                      
d1of8a-  ( 131 )    ---------------tfninkGLqsARq--LFvnLTn-------------
d1ojxa-  (  12 )    FArrg---kSIILaYdHgiehgpadfm---------------dnpdSadP
d1onra-  (  28 )    ------qPqDATTn--PslIlnAAqipeYrklIddA------vawAkqqs
d1p1xa-  (  36 )    AkTpvgnTAAICIy------------------------------------
d1rqba2  (  30 )    a--------------tra--edv-gAca-dIdaAgYwSVECwggaTydSC
d1sfla-  (   3 )                                                      
d1sr9a2  (  87 )    i---------------dpsparkrr-Fd-lLvr-gYkEIEVGf--PSas-
d1to3a-  (   9 )    ITras---ggfALAVDqR-ear--lfaaagaktpVa------dsvLtdfk
d1ub3a-  (  28 )    A--leygFyGLCIp------------------------------------
d1vcva1  (  26 )    A--eelgVaAYÇVn------------------------------------
d1vhca-  (  15 )    l--------kIvPvIaLdnaddIlpLAdtLakngLs-VAeITfrse----
d1vlia2  (  82 )    q--------------sep-aewilpLld--yCrek---------------
d1vr6a1  ( 140 )    q--------------Glg-ekGLeyLre--AAdky---------------
d1w3ia-  (   2 )                                                      
d1wa3a1  (  10 )    h--------kIVAVLrAnsveeAkekAlAVfeGgVh-LIEITftVp----
d1wbha1  (  15 )    g--------pVVPvIvVkklehAvpMAkaLvaGgVr-VLNVTLrte----
d1wx0a1  (  20 )    g-----vLsGVtTn--ptlVakaFaakge---------------------
d1xkya1  (   1 )                                                      
d1xxxa1  (   5 )                                                      
d2a21a1  (1056 )    r--------------GhgleyGvkALrk--Vkeef---------------
d2a4aa1  (  38 )    SvktcPfAaAVCVy------------------------------------
d2b7oa1  ( 165 )    d--------------PsrlvrayanAsaAnlvralTssglaslhlVHdwN
d2fiqa1  (   8 )    H--kageh-iGicSVcsahplVIeaALafDrnstrkvLIEAtSnqVNq--
d2qapa1  (  32 )    Ltt-p---gkGLLAAdesigsCtkrFqpigls--nt------eehrrqYR
d2zdra2  (  86 )    C--------------aLn-eedEikLke--yVesk---------------
                                                                      

                             260       270       280       290       300 
d1dosa-  (  70 )    gkgvk---------sdvpqgaAilGAisgAhhVh---qmAehygVP---V
d1f74a-  (   1 )                                               m--rdLk
d1gqna-  (   1 )     m--k---------tvtVk--------------nliIgeg--------mP
d1gvfa-  (  56 )    ----------------------hiaLeeIyalCs---aySttynmp---L
d1gzga-  ( 105 )    ----------------------eGIaQrATraLr---erfp-------eL
d1h7na-  ( 109 )    ----------------------agPVIqGIkfIr---eyfp-------eL
d1hl2a-  (   3 )                                               t---nLr
d1l6sa-  (  95 )    ----------------------dGLVArMSriCk---qtvp-------eM
d1l6wa-  (  37 )    ---------kp--------------ldvVLpqLh---eAmggq------g
d1n7ka-  (  58 )    ----------------------pvyTvkIsglAe---kl---------gV
d1nvma2  (  59 )    sf--n---------ygfgr---htdleyIeaVag---eIs--------hA
d1o5ka-  (   0 )                                                  hmFr
d1of8a-  ( 151 )    ----------------------------i-------------------gL
d1ojxa-  (  44 )    eyILrLA-rdAgFdGVVF--qr-giAekyyd----------------gsV
d1onra-  (  64 )    ndraqqivDAT-----------DkLaVNIGleIL---klVp--------g
d1p1xa-  (  50 )    ----------------------prfIpiAr-ktL---keqgTp-----eI
d1rqba2  (  65 )    ir--f---------l---n---edPwerLrtfrk---lp---------ns
d1sfla-  (   3 )                                                    hV
d1sr9a2  ( 119 )    ----------------------qtdfdFVreIIeqgaIpd--------dV
d1to3a-  (  50 )    vnAAki--LSpyAsaVLL--DqqFCYrqAveq--------nAva--k-sC
d1ub3a-  (  40 )    ----------------------psyVawVraryp-------hA-----pF
d1vcva1  (  38 )    ----------------------piyApvVrplLr--------------kV
d1vhca-  (  52 )    ------------------------aAadAIrlLr---anrp-------dF
d1vlia2  ( 102 )    ------------------------------------------------qV
d1vr6a1  ( 158 )    ------------------------------------------------gM
d1w3ia-  (   2 )                                                     p
d1wa3a1  (  47 )    ------------------------dAdtVIkeLs---fLke------kgA
d1wbha1  (  52 )    ------------------------cAvdAIraIa---keVp-------eA
d1wx0a1  (  42 )    --------alt-----------eeafaahLraIC---etVg--------g
d1xkya1  (   1 )                                               m--idFg
d1xxxa1  (   5 )                                           gfdva--arLG
d2a21a1  (1075 )    ------------------------------------------------gL
d2a4aa1  (  52 )    ----------------------pkfVkfInekIk---qeinpF-----kP
d2b7oa1  ( 202 )    refvr---------tSpaGarYeaLAteIdrglrfsacgvadrnlqtAeI
d2fiqa1  (  53 )    ------------------fggytgtPadFrefVf---aiAdkvgFarerI
d2qapa1  (  70 )    aLMLeAegFeqyISGVIL--hd-eTVgqkAsngq---tFPeYLt--argV
d2zdra2  ( 104 )    ------------------------------------------------gM
                                                                      

                             310       320       330       340       350 
d1dosa-  ( 105 )    ILHTDhCa---------------------kk---llpWIdgL--Ldagek
d1f74a-  (   6 )    gIFSaLL---VSFne--------dgtI---nekGLrqIIrHN--Id----
d1gqna-  (  17 )    kIIVsLmgr---------------------dinsVkaeAlay--re----
d1gvfa-  (  78 )    ALHLDhHe--------------------------slddIrrk--Vha---
d1gzga-  ( 123 )    gIITDVALdPfTthGqNGildddgyVlndvSidvLvrQAlsH--AeA---
d1h7na-  ( 127 )    yIICDVCLcEYTshghCGvlyddgtinrerSvsrLaaVAvnY--Aka---
d1hl2a-  (   7 )    gVMAALL---TPFdq--------qqal---dkaSLrrLVqfN--iq----
d1l6sa-  ( 113 )    iVMSDTCFcEYTshGhCGvleh--gVdndaTlenLgkQAvvA--AaA---
d1l6wa-  (  55 )    rLFAqVmat---------------------taegMvndAlkL--rsiia-
d1n7ka-  (  74 )    kLCSVIgFp------lGqa-----------plevKlveAqtV--Lea---
d1nvma2  (  84 )    qIATLLlPgi-------Gs----------------vhdLknA--yq----
d1o5ka-  (   4 )    gVGTaIV---TPFk---------ngeL---dleSYerLVryQ--le----
d1of8a-  ( 154 )    PIGSEmld---------------------------tisPqYL--------
d1ojxa-  (  74 )    pLILKLN---Gkttlyn---gepvSva---n-----CsVeeA--vs----
d1onra-  (  92 )    rISTEVdArlsy------------------dteaSiakAkrL--ikLYn-
d1p1xa-  (  69 )    rIATVTNFp------hGnd-----------didiAlaeTraA--iay---
d1rqba2  (  87 )    rlQ-lLrGqn-------Llgy------rhyndevVdrfVdkS--ae----
d1sfla-  (   5 )    eVVAtItpq----------------------letliqkinhr--id----
d1sr9a2  ( 139 )    tIQVLTqCr-----------------------pelIerTFqA--Cs----
d1to3a-  (  85 )    a-IVAAD---dfipg--ngipvdnvvl---dk---kInAqaV--kr----
d1ub3a-  (  56 )    rLVTVVGfp------lGyq-----------ekevKaleAalA--car---
d1vcva1  (  52 )    kLÇVVAdFp------fGal-----------ptasRialVsrl--ae----
d1vhca-  (  68 )    LIAAGtVl--------------------------taeqVvlA--ksS---
d1vlia2  ( 104 )    ifLstVcd---------------------------egSAdll--qs----
d1vr6a1  ( 160 )    yVVTeAlg---------------------------eddLpkV--Ae----
d1w3ia-  (   3 )    eIITPII---TPFtk--------dnrI---dkekLkiHAenL--ir----
d1wa3a1  (  64 )    iIGAGtVt--------------------------sveqCrkA--ves---
d1wbha1  (  68 )    iVGAGtVl--------------------------npqqlaeV--teA---
d1wx0a1  (  62 )    pVSAeVtal---------------------eaeaMVaeGrrl--aaihp-
d1xkya1  (   6 )    tIATaMV---TPFdi--------ngnI---dfakTtkLVnyL--id----
d1xxxa1  (  14 )    tLLTAMV---TPFsg--------dgsL---dtatAarLAnhL--vd----
d2a21a1  (1077 )    kITTdIhe---------------------------swqAepV--ae----
d2a4aa1  (  72 )    kIACVINFp------yGtd-----------smekVlndTekA--ldd---
d2b7oa1  ( 244 )    YaSHEALv---------------------------ldyErALrlsd-gdd
d2fiqa1  (  83 )    iLGGdhLGpn-------cwqq------envd---aAeksveL--VkaYVr
d2qapa1  ( 112 )    vPGIkTd---mglcpLlegaegEqmTe---gldgYvkrAsay--yk----
d2zdra2  ( 106 )    iFISTPfS---------------------------raAAlrL--qr----
                    bbbbb                              aaaaaaa  aa    

                             360       370       380       390       400 
d1dosa-  ( 129 )    hfaatgkPLFSsHMIdLse----------eslqenIeiCskyLerMskI-
d1f74a-  (  36 )    ----kmkVd-GLYVgG----stGENfmL------steeKkeIFrIAkdeA
d1gqna-  (  40 )    -------atFdILEWr--VDhFm--------diastqsVltAArvIrdam
d1gvfa-  (  97 )    --------gVrSAMIdGSh----------fpfaeNvklVksVVdfChsq-
d1gzga-  ( 168 )    ------gAq-vVAPSDM-Md--------------------gRIgaIreaL
d1h7na-  ( 172 )    ------gAh-CVAPSDM-Id--------------------gRIrdIkrgL
d1hl2a-  (  37 )    -----QgId-GLYVgG----stGEAfvQ------slseReqVLeIVAeeA
d1l6sa-  ( 157 )    ------gAd-fIAPsAa-Md--------------------gQVqaIrqaL
d1l6wa-  (  81 )    --------d-IVVKVpV-t-----------------aeGlaAIkmLkae-
d1n7ka-  ( 102 )    ------gAt-ELDVVPh-lsl-------------gpeaVyreVsgIVklA
d1nvma2  ( 105 )    -------AgArVVRVAThCt--------------eAdvSkqhIeyArnl-
d1o5ka-  (  33 )    -----ngVn-ALIVLg----tTGEsptV------nederekLVsrTleIV
d1of8a-  ( 169 )    ------adLVSFGAIg--ArtTe--------------sq-lhrelASgls
d1ojxa-  ( 104 )    -----lgAs-AVGYTIYPgSg-------------fewkMfeeLarikrdA
d1onra-  ( 121 )    -dagisndr-ILIKLAS-T-----------------wqGIrAAeqLeke-
d1p1xa-  (  97 )    ------gAd-EVDVVFP-YraLmag---------neqvGfdLVkaCkeaC
d1rqba2  ( 118 )    -------ng-dVfRvfda-n--------------dprn--ahAaAVkka-
d1sfla-  (  30 )    --------aIdVLELr--IDqFe--------nV-tvdqVaemItklkd--
d1sr9a2  ( 160 )    ------gAprAIVHFynsTsilqrrvvfranraeVqaiAtdGArkCveqa
d1to3a-  ( 118 )    -----dgak-ALKllvLwRs------de------daqqrln-VkeFnelC
d1ub3a-  (  84 )    ------gAd-EVDMVLh-lgrAkag---------dldyLeaEVraVreaV
d1vcva1  (  79 )    ------vAd-EIDVVAP-iglVksr---------rwaeVrrDLisVVgaA
d1vhca-  (  87 )    --------gAdFVvtpgLn--------------------pkIvklCqdl-
d1vlia2  ( 121 )    -------tspsAFKIa--syein--------------hl-pLLkyvArln
d1vr6a1  ( 177 )    -------y-AdIIqIg--arNAq--------------nf-rLLskAGsyn
d1w3ia-  (  33 )    -----kgId-kLFVNG----tTGLGpsL------speeKleNLkAVydvt
d1wa3a1  (  83 )    --------gAeFIVSphld--------------------eeISqfCkek-
d1wbha1  (  87 )    --------gAqFAISpgLt--------------------epLLkaAteg-
d1wx0a1  (  88 )    --------n-IVVkLpT-t-----------------eeGlkACkrLsae-
d1xkya1  (  36 )    -----ngTt-AIVVGg----ttGEsptL------tseekvaLYrhVvsvV
d1xxxa1  (  44 )    -----qgCd-GLVVSg----ttGEsptT------tdgekieLLraVleaV
d2a21a1  (1094 )    -------V-AdIIQIp--aflCr--------------qt-dLLlaAAktg
d2a4aa1  ( 100 )    ------gAd-EIDLVIn-YkkIientde------GlkeAtklTqsVkklL
d2b7oa1  ( 267 )    gepqLFDLsAHtVWIg--erTrq--------------idGAHIAFAqvIa
d2fiqa1  ( 116 )    A-------gFsKIHLdAss---CagDpipLapetvAerAAvLCfAAesvA
d2qapa1  ( 150 )    -----kgCr-FCKWrNVYkIqngtVses------AVrfNAetLArYAilS
d2zdra2  ( 123 )    -------mdIpAYKIg--SgeCn--------------ny-pLIklVAsFg
                               bbb                        aaaaaaaaaa  

                             410       420       430       440       450 
d1dosa-  ( 168 )    -------gMTLEIELgc------tgGeedgvdnshmdasa----------
d1f74a-  (  71 )    kd-----qIALIAQVGsv-------------------------------n
d1gqna-  (  73 )    -p-----diPLLFTFRs------akegGeqtit-----------------
d1gvfa-  ( 128 )    -------dCSVEAElgr------lgs-------------a----------
d1gzga-  ( 190 )    esaght-nvrVMAYSAKYaSayYgpfrdAVgSasnLgkgnkatyQMdpan
d1h7na-  ( 194 )    inanlahkTfVLSYAAkFsgnlygpfrdAAcSa--PsngdRkcyQlppag
d1hl2a-  (  71 )    kg-----kikLIAHVGcv-------------------------------s
d1l6sa-  ( 179 )    daagfk-dtaIMSYSTkFaSsfYgpfreAAgSa--L-kgdRksyQmnpmn
d1l6wa-  ( 103 )    -------gipTLGTaVy---------------------------------
d1n7ka-  ( 131 )    ks----ygAvVKVIL-EAplw-d---------------------------
d1nvma2  ( 133 )    -----g--MdTVGFLmm------Sh---m--ip-----------------
d1o5ka-  (  67 )    dg-----kipVIVgAGtn-------------------------------s
d1of8a-  ( 196 )    --------FPVGFkNgt-------------dGt-----------------
d1ojxa-  ( 135 )    vk----fdlPLVVWSyprgg-----------------------kvvneta
d1onra-  ( 150 )    -------gInCNLTLLF---------------------------------
d1p1xa-  ( 130 )    aa----anVlLKVII-ETgeLkd---------------------------
d1rqba2  ( 146 )    -----g--khaQgtIcY------ti---spvht-----------------
d1sfla-  (  62 )    -------sfkLLVTYRt------klQgGyGqft-----------------
d1sr9a2  ( 204 )    -akypgTqWrfEYSPes------Yt---g--Te-----------------
d1to3a-  ( 150 )    hs----nGLLSIIePvVrpPrc--------------------gdkf--dr
d1ub3a-  ( 117 )    p------qAvLKVIL-ETGyF-s---------------------------
d1vcva1  ( 112 )    g------grvVKVIT-EEPyL-r---------------------------
d1vhca-  ( 108 )    -------nFpITPGVn----------------------------------
d1vlia2  ( 147 )    --------rPi-FsTA--------------gAe-----------------
d1vr6a1  ( 202 )    --------kpVLLKRGf-------------mNt-----------------
d1w3ia-  (  67 )    n--------kIIFQVGgl-------------------------------n
d1wa3a1  ( 104 )    -------gvfYMPGVm----------------------------------
d1wbha1  ( 108 )    -------tiPLIPGIs----------------------------------
d1wx0a1  ( 110 )    -------gikVNMTlIf---------------------------------
d1xkya1  (  70 )    dk-----rvpVIAgTGsn-------------------------------n
d1xxxa1  (  78 )    Gd-----rArVIAgAGty-------------------------------d
d2a21a1  (1119 )    --------rAVNVKKGq-------------fLa-----------------
d2a4aa1  ( 136 )    t------nkiLKVII-EVGeLkt---------------------------
d2b7oa1  ( 301 )    --------NPVgVKlGp-------------n-t-----------------
d2fiqa1  ( 157 )    -tdcqreqLsYVIgtev------p--------------vv----------
d2qapa1  ( 188 )    Qm----SGLVPIVEPeVmid----------------------gkhdidtC
d2zdra2  ( 149 )    --------kpIILSTG--------------mns-----------------
                              bbbb                                    

                             460       470       480       490       500 
d1dosa-  ( 195 )    lyTqpedVdyAyteL-----sk-----------isprFTIAAs-------
d1f74a-  (  85 )    lkeAveLGkyAtel-------------gYd--------CLSAvtPfy---
d1gqna-  (  94 )    tqhYltLNraAIdsg--------------------lVdMIDLE-------
d1gvfa-  ( 153 )    flTdpqeAkrFvelT--------------------gVdSLAVA-------
d1gzga-  ( 239 )    sdeAlheVaaDlae-------------gAd--------mVMVkPG-----
d1h7na-  ( 242 )    rglArrALerDmse-------------gAd--------GIIVKPS-----
d1hl2a-  (  85 )    taeSqqLAaSAkry-------------gFd--------AVSAVTPfy---
d1l6sa-  ( 225 )    rreAireSlldeaq-------------gAd--------CLMVKPA-----
d1l6wa-  ( 113 )    ---gaaqGllSAla-------------gAe--------YVAPyVnridaq
d1n7ka-  ( 148 )    dktLslLVdsSrrA-------------gAd--------iVKTSTgv----
d1nvma2  ( 148 )    aekLAeqGklMesy---------------------gAtCIYMA-------
d1o5ka-  (  81 )    tekTlklVkqAekl-------------gAn--------GVlVvTPyy---
d1of8a-  ( 208 )    lnvAvdAcqaAahshhfmgvtkhgvaaittT-kGNehCFVILr-------
d1ojxa-  ( 158 )    peiVayAAriAlel-------------gAd--------AMKIkYTg----
d1onra-  ( 160 )    ---SfAQArACAeA-------------gVf--------LISPfVGrILdw
d1p1xa-  ( 148 )    ealIrkASeiSIkA-------------gAd--------FIKTSTgkv---
d1rqba2  ( 163 )    vegYvklAgqlld----------------------gadSIALD-------
d1sfla-  (  82 )    ndsYLnLIsdLAnin--------------------gIdMIDIE-------
d1sr9a2  ( 225 )    leYAkqVCdaVgevIaPtpe---------------rpIIFNlP-------
d1to3a-  ( 174 )    eqaIIdAAkeLGds-------------gAd--------LYKVeplygk--
d1ub3a-  ( 132 )    peeIarLAeAAirG-------------gAd--------FLKTSTgfg---
d1vcva1  ( 127 )    deERytLYdIIaeA-------------gAh--------FIKSSTgfA---
d1vhca-  ( 117 )    ---np-aIeiAle----------------------gisaVkFf-------
d1vlia2  ( 158 )    isdVheAwrtirae-------------------gN-nqIAIHc-------
d1vr6a1  ( 214 )    ieeFLlSAeyIAns-------------------gNtkIILCEr-------
d1w3ia-  (  78 )    lddAirLAklSkdf-------------dIv--------GIASYAPyy---
d1wa3a1  ( 113 )    ---tpteLvkAmkl---------------------ghtILKLf-------
d1wbha1  ( 117 )    ---tvseLmlGmdy---------------------glkEFKFf-------
d1wx0a1  ( 120 )    ---sanqAllAAra-------------gAs--------YVsPfLGrvddi
d1xkya1  (  84 )    thaSidlTkkAtev-------------gVd--------AVMLvAPyy---
d1xxxa1  (  92 )    tahSirLAkaCaae-------------gAh--------GLLVvTPyy---
d2a21a1  (1131 )    pwdTknVVekLkfg-------------------gAkeIYLTEr-------
d2a4aa1  ( 152 )    edlIikTTlaVLnG-------------nAd--------FIKTSTgkv---
d2b7oa1  ( 313 )    pelAveYVerLDph------------------nkpGrLtLVsr-------
d2fiqa1  ( 186 )    hithvedAantlrTH-----qkaFiar-glteAltRViAiVVq-------
d2qapa1  ( 212 )    QrvSehVWreVvaA--------Lqr-hgVIweGC----LLKPnMVvPGa-
d2zdra2  ( 160 )    iesIkkSVeiIrea-------------------gV-pYALLhC-------
                     aaaaaaaaaaaa                         bbbb        

                             510       520       530       540       550 
d1dosa-  ( 222 )    FGnvhg-vykagnVv----ltptiLrdSqeyVskkhnlp---hnsLnFVF
d1f74a-  ( 111 )    -----------y--kfsfpeIkhYYdtIIa---------eT---gsnMIV
d1gqna-  ( 117 )    -----Lftgda--------dVkaTVdyAhah-------------nVyVVM
d1gvfa-  ( 176 )    IgTahg-ly-sktpk----IdfqrLaeIrevV------------dvPLVL
d1gzga-  ( 263 )    ------------------mpyldIVrrVkdef------------rapTfV
d1h7na-  ( 266 )    ------------------tfyldIMrdAseiCk-----------dlpICA
d1hl2a-  ( 111 )    -----------y--pfsfeeHCdHYraIid---------sA--dglpMVV
d1l6sa-  ( 249 )    ------------------gayldIVreLrerT------------elpIGA
d1l6wa-  ( 139 )    -g----------------gsGiqtVtdLhqlLkmhap-------qAkVLA
d1n7ka-  ( 173 )    ---------------ytkGGdpvtVfrLAslAkpl---------gMgVKA
d1nvma2  ( 170 )    D--sGGaMsmn--------dIrdrMraFkavLk-p---------eTqVGM
d1o5ka-  ( 107 )    -----------n--kptqegLyqHYkyISe---------rT---dlgIVV
d1of8a-  ( 250 )    G--gk-----kg-tn----ydaksVaeAkaqlpa-g--------sngLMI
d1ojxa-  ( 183 )    --------------------dpktFswAvk---------vAg--kvpVLM
d1onra-  ( 186 )    -yk--antdkkey-apaeDpGVvsVseIYqyYkehgY-------eTvVMG
d1p1xa-  ( 174 )    -----a-----------vnAtpesAriMMevIrdmg-----vektVGFKP
d1rqba2  ( 187 )    ----aAlLkpq--------pAydIIkaIKdtyg-q---------ktqINL
d1sfla-  ( 105 )    W--q-adidie--------kHqriIthLqqy-------------nKeVII
d1sr9a2  ( 253 )    A--tvEt-tpn--------vyAdsIewsrnlanre---------SViLSL
d1to3a-  ( 202 )    ---------------garsdLltaSqrLng---------hIn----pWVI
d1ub3a-  ( 158 )    ---------p-------rgAsleDValLvrvAq--g--------raqVKA
d1vcva1  ( 153 )    -----eeayAarq-gnpvhstperAaaIAryIkekgy-------rLGVKM
d1vhca-  ( 136 )    pAe------asg--------gvk-Ikallgpya-----------qLq-IP
d1vlia2  ( 182 )    V--akypAppey-------SnLsVIp-LaaaFp-----------eAVIgF
d1vr6a1  ( 238 )    G--irtfekatr-nt----LdisAVpiIrkeS------------HLPILV
d1w3ia-  ( 104 )    -----------yp-rmsekhlvkyFktLçe---------vS---phpVYL
d1wa3a1  ( 132 )    pGe------vv---------gpqfVkamkgpfp-----------nVkFVP
d1wbha1  ( 136 )    pAe------ang--------gvkaLqaiagpfs-----------qVrFCP
d1wx0a1  ( 146 )    -s----------------wdGGelLreIVemiqvqdL-------pVkVIA
d1xkya1  ( 110 )    -----------n--kpsqegMyqhFkaIAe---------sT---plpVML
d1xxxa1  ( 118 )    -----------s--kppqrgLqaHFtaVAd---------at---elPMLL
d2a21a1  (1155 )    G--ttfg--ynn-Lv----VdfrSLpiMkq--------------wakVIY
d2a4aa1  ( 178 )    -----q-----------inAtpssVeyIIkAIkeYiknnpeknnkIGLKV
d2b7oa1  ( 339 )    G--nh--------------kVrdlLppiVekVqatgh-------qVIWQC
d2fiqa1  ( 223 )    PgVefd---hsniih----YqpqeAqaLAqwIe----------ntrVYEA
d2qapa1  ( 248 )    ---------eSgk-tAapeqVAhyTVmTLa--------rTMpamLpGVMF
d2zdra2  ( 183 )    t--niypTpyed-------vrlggMndLseaFp-----------dAIiGL
                                         aaaaaaaaa                 bbb

                             560       570       580       590       600 
d1dosa-  ( 264 )    HgGs---------------------gStaqeIkdSvsy------------
d1f74a-  ( 136 )    ysIp---flt-------------gvnmGieqFgeLYk-n----------p
d1gqna-  ( 141 )    SN---------Hdfh-----qTpsaeeMvsrLrkMqal------------
d1gvfa-  ( 208 )    HgAS---------------------dVpdefVrrTIel------------
d1gzga-  ( 283 )    YQVSgEYamhm---gaiqngwlae-svIleSLtaFkragA----------
d1h7na-  ( 287 )    YHVSgEYamlh---aaaekgvvdlktiAfesHqgFLragA----------
d1hl2a-  ( 137 )    YNiparSgvk----------------LtldqIntLVt-L----------p
d1l6sa-  ( 269 )    YQVSgeYamik---faalagaideekvVlesLgsIkragA----------
d1l6wa-  ( 165 )    asFk-----------------------tprqAldCllagC----------
d1n7ka-  ( 199 )    sg--gIr--------------------sGidAvlAVGAgA----------
d1nvma2  ( 200 )    HA---------HhNl-----s-----lGvaNSivAvee------------
d1o5ka-  ( 132 )    yNvpgrTgvn----------------VlpetAarIAadL----------k
d1of8a-  ( 279 )    DYShgN----Sn----------kdfrnQpkVNdvVceqIangen------
d1ojxa-  ( 202 )    sGg---pktk-------------teedFlkqVegVle------------A
d1onra-  ( 225 )    asFr-----------------------nigEIleLA--GC----------
d1p1xa-  ( 203 )    Ag--gVr--------------------tAedAqkYLaiAdelFgadwAda
d1rqba2  ( 215 )    hC---------hStT-----g-----vTevSL-kAieA------------
d1sfla-  ( 131 )    Sh---------Hnfe-----sTppldeLqfiFfkMqkF------------
d1sr9a2  ( 285 )    HP---------Hndr-----g-----tAvaAAelGFaA------------
d1to3a-  ( 225 )    LSs---gvd---------------eklFpraVrVAe-------------A
d1ub3a-  ( 182 )    Ag--gIr--------------------dretAlrMlkag-----------
d1vcva1  ( 190 )    ag--gIr--------------------treqAkaIVdaIg-----wgedp
d1vhca-  ( 161 )    tg-----------------------gIglhnIrdYlaip-----------
d1vlia2  ( 212 )    sD-hse--------------------hpteAPcAAVrl------------
d1vr6a1  ( 269 )    DPShSG-----Gr-----------rdlViplSraAIav------------
d1w3ia-  ( 130 )    YNyptaTgkd----------------IdAkvAkeIg--------------
d1wa3a1  ( 156 )    tg-----------------------gVnldnVçeWfkAg-----------
d1wbha1  ( 161 )    tg-----------------------gIspanYrdYlalk-----------
d1wx0a1  ( 172 )    asIr-----------------------hprHvteAallgA----------
d1xkya1  ( 135 )    ynvpgrSivq----------------IsvdTVvrLSe-i----------e
d1xxxa1  ( 143 )    YDipgrSavp----------------IepdtIraLAs-h----------p
d2a21a1  (1182 )    DAThSV-----qlpgglgdksGGmrefIfplIraAVav------------
d2a4aa1  ( 212 )    sg--gIs--------------------dlntAshYillarrfls------
d2b7oa1  ( 366 )    DP-hgN-----thess-tgfktrhfdrIvdEVqGFfeVHralgt------
d2fiqa1  ( 257 )    HsTD---------------------yQtrtaYweLVrD------------
d2qapa1  ( 280 )    lSg---gls---------------evqASeYLnaInnSp-------lprp
d2zdra2  ( 213 )    SD-HTl--------------------dn-yaClgAVal------------
                                                aaaaaaaa              

                             610       620       630       640       650 
d1dosa-  ( 281 )    GVVKmnid--tdTqwatwegvlnyyka----------neaylqg------
d1f74a-  ( 159 )    kVlGVkFtagdfyLLerLkkayp----nhlIWAGfdemMlpAAslgVdGA
d1gqna-  ( 165 )    gAdIPKIAV-mPq-skhdVltLltATl----------eMqqhyadrPVIT
d1gvfa-  ( 225 )    gVTKVnVa--teLkiafagavkawfae----------np-----------
d1gzga-  ( 319 )    --dgILTY-FAkqAAeqlr-r                             
d1h7na-  ( 324 )    --rlIITY-LApeFLdwld-e                             
d1hl2a-  ( 160 )    gVgALKQTsgdlyqMeqIrrehp----dlvLYNGydeiFasGllagAdGG
d1l6sa-  ( 306 )    --dlIFSY-FAldLAekkilr                             
d1l6wa-  ( 182 )    --eSITLp---ldVAqqmisy-----------------------------
d1n7ka-  ( 217 )    --diIGts-sAvkVLesfkslv                            
d1nvma2  ( 219 )    gCdrVDAS--LAgMGagAGNApLevFI----------avAerl-gwnHgT
d1o5ka-  ( 156 )    nVvGI-EAnpdidqIdrTVslTkqarsdFMVWSgnDdrTFyLLcagGDGV
d1of8a-  ( 309 )    aItGVMIESnInegnqgilkyGvSItd----------a-----------C
d1ojxa-  ( 224 )    gAlGIAVg----rNVWqrr-------------------------------
d1onra-  ( 240 )    --drLTIa---palLkeLaesegaierkLsytg-----------------
d1p1xa-  ( 231 )    rhYRFgas-sLLasLlkalgh                             
d1rqba2  ( 234 )    gVdVVDTA--IssSl-GpGHNpTesvA----------el-egt-gytTnL
d1sfla-  ( 155 )    nPeYVKLAV-mPh-nkndvlnLlqAMs----------tfsdt-mdckVVG
d1sr9a2  ( 304 )    gAdRIEGC--LFgnGertGNVCLVtLG----------lnlfsr-gvdPqI
d1to3a-  ( 245 )    gAsGFlAG----rAVwssViglp---------------------------
d1ub3a-  ( 199 )    -AsRLGTs-sGvaLva                                  
d1vcva1  ( 213 )    arVrLGts-tPeaLl                                   
d1vhca-  ( 177 )    nIvACgg---swFVekklIq------------------------------
d1vlia2  ( 229 )    gAkLIekhFTidkn--------lpgad----------Hsf---------A
d1vr6a1  ( 291 )    gAhGIIVEVhpepe--------kAlsd----------gkq---------S
d1w3ia-  ( 150 )    çFtGVkDtieniihTldYkrlnp----nMlVYSGsDmlIAtVAstgLdGN
d1wa3a1  ( 172 )    -VlAVGVg--saLVk-----------------------------------
d1wbha1  ( 177 )    sVlCIGg---swLVpadALe------------------------------
d1wx0a1  ( 189 )    --dIATMp---havFkqllkh-----------------------------
d1xkya1  ( 158 )    nIvAIkDaggdvltMteIiekTa---ddFaVYSGdDglTlpAMavgAkGI
d1xxxa1  ( 166 )    nIvGVKDakadlhsGaqImadt-----gLaYYSGdDalNlpWLamgAtGF
d2a21a1  (1215 )    gCdGVFMETHpepe--------kAlSd----------asT---------Q
d2a4aa1  ( 240 )    dnfRIGss-sLVikLrkvis                              
d2b7oa1  ( 404 )    hPGGIHvEITgenVtla--gryeTacd----------P-----------R
d2fiqa1  ( 274 )    hFAILKVG--pALTfaLReAifAlaqi----------eqeliapenrSg-
d2qapa1  ( 305 )    YfLSFSYa----rALQssAlkaWgGk------------------------
d2zdra2  ( 229 )    GGSILERHFTdrmd--------rpgpd----------IvC---------S
                       bbbb                                           

                             660       670       680       690       700 
d1dosa-  ( 313 )    --------------------------------------------------
d1f74a-  ( 205 )    IgsTFNVNGvrArqIfelTka------gklkeAleiqhvTndLIegIlan
d1gqna-  ( 203 )    mSm--akeGviSRlagevfgS-aAtfGavkqasapGqiaVndLrsvLmil
d1gvfa-  ( 252 )    --------------------------------------------------
d1gzga-                                                               
d1h7na-                                                               
d1hl2a-  ( 206 )    IgsTYNIMGwRYqgIvkAlke------gdiqtAqklqteCnkVidlLikT
d1l6sa-                                                               
d1l6wa-  ( 198 )    --------------------------------------------------
d1n7ka-                                                               
d1nvma2  ( 256 )    d----lytLmdAAddi--Vrp-l----Qd-----rpVrvdretlglGyaG
d1o5ka-  ( 206 )    iSvVSNVAPkqMveLCaeyfs------gnlekSrevHrkLrpLMkALfve
d1of8a-  ( 345 )    IgwetTedVLrkLAaAVrqRrevn                          
d1ojxa-  ( 239 )    ----------------------------------dAlkFAraLaelVy  
d1onra-  ( 268 )    --------------------------------------------------
d1p1xa-                                                               
d1rqba2  ( 271 )    d----ydrLhkIrdhfkairp-k----yk-----kfesktlvdtsifks-
d1sfla-  ( 192 )    iSm--sklGliSrtAQgvfgG-aLTyGcigepqapGqidVtdLkaqvtly
d1sr9a2  ( 341 )    d----Fsnideirrtveycnq-l--------------pVherhpyGGdl 
d1to3a-  ( 264 )    ---------------------------dtelLrdvSApkLqrLGeIvdeg
d1ub3a-                                                               
d1vcva1                                                               
d1vhca-  ( 194 )    --------------------------------------------------
d1vlia2  ( 252 )    LnpdeLke-VdgIrkteaelkqgitkpVsekllgssyKtttaieg     
d1vr6a1  ( 314 )    LdfelFkeLVqeMkklAdal--gvkvn                       
d1w3ia-  ( 196 )    VAaGSNYLPeVTvtIkklAme------rkideAlkLQflHdeVieaSrif
d1wa3a1  ( 184 )    --------------------------------------------------
d1wbha1  ( 194 )    --------------------------------------------------
d1wx0a1  ( 205 )    --------------------------------------------------
d1xkya1  ( 205 )    VSvASHVIGneMqeMIaafqa------gefkkAqklhqlLvrVtdsLfma
d1xxxa1  ( 211 )    ISvIAHLAAgqLreLlsafgs------gdiatArkiniaVapLcnAmsrL
d2a21a1  (1238 )    LplsqLegiIeaIleirevaskyyeti                       
d2a4aa1                                                               
d2b7oa1  ( 444 )    lntqqSLeLaFlVAeLrd                                
d2fiqa1  ( 311 )    -----ClavIeeVldepqywkkyYrtgfndsllDirySlsDrIryyWphs
d2qapa1  ( 327 )    -------------------es------glaaGrraFlhRArMNsmAqlGk
d2zdra2  ( 252 )    MnpdtFkeLkqgAhalklaRgg-----------------------kkdti
                                                                      

                             710       720       730       740       750 
d1dosa-  ( 313 )    ------------qlgnpkgedqpnkkyydprv------wlraGqtsMiar
d1f74a-  ( 249 )    glylTIKeLLkle---------g-vdAgyCrepmtskataeqvakAkdLk
d1gqna-  ( 250 )    hna                                               
d1gvfa-  ( 252 )    --------------------qg-----ndpry------ymrvGMdaMkev
d1gzga-                                                               
d1h7na-                                                               
d1hl2a-  ( 250 )    gvfrGLKTVLhyM---------dVVsvplCrkpfg-pVdekylpeLkaLA
d1l6sa-                                                               
d1l6wa-  ( 198 )    ------------------------------------pavdaavakfeqdw
d1n7ka-                                                               
d1nvma2  ( 290 )    v                                                 
d1o5ka-  ( 250 )    tNPiPVKAALnlm---------g-fIeneLrlplv-pAsekTvelLrnvL
d1of8a-                                                               
d1ojxa-                                                               
d1onra-  ( 268 )    ------evkarpa---------rIteseFlwqhnqdpMAvdklaeGirkF
d1p1xa-                                                               
d1rqba2  ( 306 )    q                                                 
d1sfla-                                                               
d1sr9a2                                                               
d1to3a-  ( 290 )    ----kr                                            
d1ub3a-                                                               
d1vcva1                                                               
d1vhca-  ( 194 )    ----------------------------------------snnwdeIgrl
d1vlia2                                                               
d1vr6a1                                                               
d1w3ia-  ( 240 )    gslsSNYvLTkyF---------QgydLgyPrppif-pLddeeerqLikkV
d1wa3a1  ( 184 )    -----------------------------------------gtpdeVrek
d1wbha1  ( 194 )    ----------------------------------------agdydrItkl
d1wx0a1  ( 205 )    ------------------------------------pltdigl       
d1xkya1  ( 249 )    pSPTPVKtALqmv---------g-ldVgsVrlpll-pLteeervtLqsvM
d1xxxa1  ( 255 )    ggvTLSKaGLrlq---------g-idVgdPrlpqv-aAtpeqidaLaadM
d2a21a1                                                               
d2a4aa1                                                               
d2b7oa1                                                               
d2fiqa1  ( 357 )    rIknsvetvnlqgvdIplgIsqyLpkQferiqsgelsaiphqLiDkIydv
d2qapa1  ( 352 )    YkrsdD                                            
d2zdra2  ( 279 )    iag                                               
                                                                      

                             760   
d1dosa-  ( 345 )    LekaFqeLnAidvl 
d1f74a-  ( 289 )    akfls          
d1gqna-                            
d1gvfa-  ( 271 )    VrnkInVCgSanris
d1gzga-                            
d1h7na-                            
d1hl2a-  ( 290 )    qqLmqer-------g
d1l6sa-                            
d1l6wa-  ( 212 )    qgafgrtsi      
d1n7ka-                            
d1nvma2                            
d1o5ka-  ( 289 )    kesgll         
d1of8a-                            
d1ojxa-                            
d1onra-  ( 303 )    aidqekLekmIgdll
d1p1xa-                            
d1rqba2                            
d1sfla-                            
d1sr9a2                            
d1to3a-                            
d1ub3a-                            
d1vcva1                            
d1vhca-  ( 204 )    VreVidiike     
d1vlia2                            
d1vr6a1                            
d1w3ia-  ( 280 )    egirakLvelkilke
d1wa3a1  ( 193 )    AkaFvekIrgç    
d1wbha1  ( 204 )    AreAvegAkl     
d1wx0a1                            
d1xkya1  ( 288 )    qsIpr          
d1xxxa1  ( 294 )    raAsvlr        
d2a21a1                            
d2a4aa1                            
d2b7oa1                            
d2fiqa1  ( 411 )    LraYryGCae     
d2qapa1                            
d2zdra2                            
                                   

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x
beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x
hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla ç
positive phi: italic x

Jmol view

Jmol Model View
Jmol Command prompt
Response Logs

Tree based on RMSD between structures

Matrices

1. Percentage Identity Matrix  [View | Download]
2. Distance Matrix  [View | Download]

PCA based on sequence identity

1. PCA  [View]
2. Plot file  [Download]

CUSP Results

CUSP Result   [View | Download]

Alistat - Alignment Statistics

Alignment Statistics  [Download]

SMotif - Conserved Structural Motifs

SMotif Result   [View | Download]

MeanRMS

MeanRMS  [Download]