PASS2
  • Superfamily Details
  • Alignment & HMM
  • Jmol View
  • Features

Superfamily Details

Superfamily summary
Superfamily Name:  Prefoldin
Class Name:  All alpha proteins
Fold Name:  Long alpha-hairpin
Number of Members:  2
Average Size: 
Members
SCOP ID Name Source
d1fxkc- Prefoldin alpha subunit Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
d1fxka- Prefoldin beta subunit Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Alignment Based On Similarities In Structural Features using Comparer

                             10        20        30        40        50  
d1fxka-  (   5 )    qnvqhqlaqfqqlqqqaqaisvqkqtVe-qineTqkaleeLsraad----
d1fxkc-  (   5 )    aalaeivaqlniyqsqveliqqqmeavratiseleilektlsdiqgkdgs
                      aaaaaaaaaaaaaaaaaaaaaaaaa   aaaaaaaaaaaaa       

                             60        70        80        90        100 
d1fxka-  (  51 )    ------------------daevykssg-nilirvakdelteelqekletl
d1fxkc-  (  55 )    etlvpvgagsfikaelkdTsevimsvgagvaikknfedAmesIksqknel
                                         bbbbb   bbbbb aaaaaaaaaaaaaaa

                             110       120       130 
d1fxka-  (  82 )    qlrektIerqeerv-kklq-eqvniqeak    
d1fxkc-  ( 105 )    estlqkmgenlraitdimmklspqaeellaava
                    aaaaaaaaaaaaa         aaaa       

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x
beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x
hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla ç
positive phi: italic x

Jmol view

Jmol Model View
Jmol Command prompt
Response Logs

Matrices

1. Percentage Identity Matrix  [View | Download]
2. Distance Matrix  [View | Download]

CUSP Results

CUSP Result   [View | Download]

Alistat - Alignment Statistics

Alignment Statistics  [Download]

SMotif - Conserved Structural Motifs

SMotif Result   [View | Download]

MeanRMS

MeanRMS  [Download]