PASS2
  • Superfamily Details
  • Alignment & HMM

Superfamily Details

Superfamily summary
Superfamily Name:  Hypothetical protein MTH677
Class Name:  Alpha and beta proteins (a+b)
Fold Name:  Hypothetical protein MTH677
Number of Members:  1
Average Size: 
Members
SCOP ID Name Source
d1pu1a- Hypothetical protein MTH677 Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Alignment Based On Similarities In Structural Features using Comparer

                             10        20        30        40        50  
d1pu1a-  (   1 )    mslrkltegdldeissflhntisdfilkrvsakeivdiditvlveytdel
                           aaaaaaaaaaaaaaaaaaaa       bbbbbbbbbbbb   b

                             60        70        80        90  
d1pu1a-  (  51 )    kvdisAelyldelsdadpgivdeAvdaAyrslesfldgfre
                    bbbbbbbbbb         aaaaaaaaaaaaaaaaaaaaa 

solvent inaccessible: UPPER CASE X
solvent accesible: lower case x
alpha helix: red x
beta strand: blue x
3 - 10 helix: maroon x
hydrogen bond to main chain amide: bold x
hydrogen bond to mainchain carbonyl: underline x
disulphide bond: cedilla ç
positive phi: italic x