PIR format description

1.First line starts with >P1; followed by protein code
2.Second line contains textual description of the sequence
3.One or more lines containing the sequence itself.The end of the sequence is marked by a "*" characterds


Example
>P1;1h7wa1
structureX:1h7wa1:   2 :A: 183 :A:undefined:undefined: 1.90:99.90
APVLSKDVADIESILALNPRTQSHAALHSTLAKKLDKKHWKRNPDKNCFHCEKLENNFDDIKHTTLGERGALREA
MRCLKCADAPCQKSCPTHLDIKSFITSISNKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGSIN
IGGLQQFASEVFKAMNIPQIRNPCLPSQEKMP*