•   Superfamily list
 •   Fold list
Phyletic Distribution
 •   Phylum
 •   Class
 •   Order
 •   Genus
Quick Search :
 •   Dr.R.Sowdhamini
Home | Genomes | Tools | Search | Download | Links | Help | Lab page

ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase

 Superfamily name   : ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
 Fold name          : ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
 Number of sequence : 1443
 Number of genomes  : 484

Clik on the gi code to get relevent information from NCBI

16081092 ------------------------------------------------------------ 16126721 ------------------------------------------------------------ 22963829 ------------------------------------------------------------ 22989182 ------------------------------------------------------------ 17547798 ------------------------------------------------------------ 22979217 ------------------------------------------------------------ 23013649 ------------------------------------------------------------ 22967281 ------------------------------------------------------------ 22998770 ------------------------------------------------------------ 23125239 ------------------------------------------------------------ 22998928 ------------------------------------------------------------ 22999655 ------------------------------------------------------------ 22999372 ------------------------------------------------------------ 23016213 ------------------------------------------------------------ 23001019 ------------------------------------------------------------ 23102095 ------------------------------------------------------------ 23016211 ------------------------------------------------------------ 16330584 ------------------------------------------------------------ 15641361 ------------------------------------------------------------ 22998978 ------------------------------------------------------------ 22998577 ------------------------------------------------------------ 22999846 ------------------------------------------------------------ 23000440 ------------------------------------------------------------ 22999533 ------------------------------------------------------------ 22999650 ------------------------------------------------------------ 22999289 ------------------------------------------------------------ 16330590 ------------------------------------------------------------ 22998460 ------------------------------------------------------------ 22999474 ------------------------------------------------------------ 23000229 ------------------------------------------------------------ 23001466 ------------------------------------------------------------ 23000654 ------------------------------------------------------------ 23027858 ------------------------------------------------------------ 22963532 ------------------------------------------------------------ 13591555 ------------------------------------------------------------ 16904238 ------------------------------------------------------------ 5225252 ------------------------------------------------------------ 16329802 ------------------------------------------------------------ 20198952 ------------------------------------------------------------ 23053202 ------------------------------------------------------------ 21885294 ------------------------------------------------------------ 21243225 ------------------------------------------------------------ 21231797 ------------------------------------------------------------ 23102206 ------------------------------------------------------------ 15598658 ------------------------------------------------------------ 23020868 ------------------------------------------------------------ 23112091 ------------------------------------------------------------ 23053622 ------------------------------------------------------------ 23055398 ------------------------------------------------------------ 23020543 ------------------------------------------------------------ 1346440 ------------------------------------------------------------ 463195 ------------------------------------------------------------ 14906039 ------------------------------------------------------------ 10178628 ------------------------------------------------------------ 23059895 ------------------------------------------------------------ 2439990 ------------------------------------------------------------ 808104 ------------------------------------------------------------ 13641117 ------------------------------------------------------------ 15596125 ------------------------------------------------------------ 23102809 ------------------------------------------------------------ 23105439 ------------------------------------------------------------ 23001649 ------------------------------------------------------------ 23027374 ------------------------------------------------------------ 23026365 ------------------------------------------------------------ 23027857 ------------------------------------------------------------ 23014385 ------------------------------------------------------------ 23015108 ------------------------------------------------------------ 21241265 ------------------------------------------------------------ 21229958 ------------------------------------------------------------ 16329648 ------------------------------------------------------------ 3955036 ------------------------------------------------------------ 23126935 ------------------------------------------------------------ 17231253 ------------------------------------------------------------ 17229771 ------------------------------------------------------------ 22298825 ------------------------------------------------------------ 22298419 ------------------------------------------------------------ 17230367 ------------------------------------------------------------ 16761737 ------------------------------------------------------------ 16766264 ------------------------------------------------------------ 15803307 ------------------------------------------------------------ 2073556 ------------------------------------------------------------ 2463029 ------------------------------------------------------------ 16123530 ------------------------------------------------------------ 15642449 ------------------------------------------------------------ 23053150 ------------------------------------------------------------ 23000161 ------------------------------------------------------------ 23000657 ------------------------------------------------------------ 23026553 ------------------------------------------------------------ 23013889 ------------------------------------------------------------ 13472804 ------------------------------------------------------------ 22999284 ------------------------------------------------------------ 16124840 ------------------------------------------------------------ 16124905 ------------------------------------------------------------ 23001602 ------------------------------------------------------------ 22998518 ------------------------------------------------------------ 22979714 ------------------------------------------------------------ 23012559 ------------------------------------------------------------ 23012953 ------------------------------------------------------------ 15601465 ------------------------------------------------------------ 15600175 ------------------------------------------------------------ 22962312 ------------------------------------------------------------ 16124282 ------------------------------------------------------------ 16127421 ------------------------------------------------------------ 16126740 ------------------------------------------------------------ 16127449 ------------------------------------------------------------ 16127218 ------------------------------------------------------------ 16127332 ------------------------------------------------------------ 22998767 ------------------------------------------------------------ 23014840 ------------------------------------------------------------ 22954099 ------------------------------------------------------------ 22961592 ------------------------------------------------------------ 22963653 ------------------------------------------------------------ 23000388 ------------------------------------------------------------ 22959449 ------------------------------------------------------------ 22967730 ------------------------------------------------------------ 13473203 ------------------------------------------------------------ 13473249 ------------------------------------------------------------ 22958049 ------------------------------------------------------------ 21398939 ------------------------------------------------------------ 22988264 ------------------------------------------------------------ 13472176 ------------------------------------------------------------ 23125110 ------------------------------------------------------------ 21224094 ------------------------------------------------------------ 21225602 ------------------------------------------------------------ 23019494 ------------------------------------------------------------ 23020660 ------------------------------------------------------------ 22999729 ------------------------------------------------------------ 21242035 ------------------------------------------------------------ 21230642 ------------------------------------------------------------ 22998198 ------------------------------------------------------------ 23000653 ------------------------------------------------------------ 23000375 ------------------------------------------------------------ 23000437 ------------------------------------------------------------ 23001024 ------------------------------------------------------------ 22999127 ------------------------------------------------------------ 22999563 ------------------------------------------------------------ 22999905 ------------------------------------------------------------ 23000166 ------------------------------------------------------------ 22999962 ------------------------------------------------------------ 23014204 ------------------------------------------------------------ 22998278 ------------------------------------------------------------ 23000401 ------------------------------------------------------------ 22999159 ------------------------------------------------------------ 22999727 ------------------------------------------------------------ 22998631 ------------------------------------------------------------ 22998646 ------------------------------------------------------------ 23126479 ------------------------------------------------------------ 23128323 ------------------------------------------------------------ 23130312 ------------------------------------------------------------ 17228134 ------------------------------------------------------------ 23129372 ------------------------------------------------------------ 17228884 ------------------------------------------------------------ 23127221 ------------------------------------------------------------ 23129844 ------------------------------------------------------------ 16330678 ------------------------------------------------------------ 22298910 ------------------------------------------------------------ 23000906 ------------------------------------------------------------ 15889688 ------------------------------------------------------------ 23011796 ------------------------------------------------------------ 15803750 ------------------------------------------------------------ 16131100 ------------------------------------------------------------ 16762090 ------------------------------------------------------------ 7212861 ------------------------------------------------------------ 15602178 ------------------------------------------------------------ 1122856 ------------------------------------------------------------ 15800913 ------------------------------------------------------------ 16120593 ------------------------------------------------------------ 21243758 ------------------------------------------------------------ 21232279 ------------------------------------------------------------ 23121089 ------------------------------------------------------------ 21243755 ------------------------------------------------------------ 21243756 ------------------------------------------------------------ 21232278 ------------------------------------------------------------ 23101880 ------------------------------------------------------------ 20090861 ------------------------------------------------------------ 23135284 ------------------------------------------------------------ 16330151 ------------------------------------------------------------ 1679757 ------------------------------------------------------------ 22086084 ------------------------------------------------------------ 22967903 ------------------------------------------------------------ 19115322 ------------------------------------------------------------ 23103341 ------------------------------------------------------------ 23058955 ------------------------------------------------------------ 15599307 ------------------------------------------------------------ 22968449 ------------------------------------------------------------ 15596808 ------------------------------------------------------------ 23059907 ------------------------------------------------------------ 22999065 ------------------------------------------------------------ 22999855 ------------------------------------------------------------ 16761198 ------------------------------------------------------------ 16765598 ------------------------------------------------------------ 147525 ------------------------------------------------------------ 15598240 ------------------------------------------------------------ 23058959 ------------------------------------------------------------ 17231257 ------------------------------------------------------------ 4336932 ------------------------------------------------------------ 17231988 ------------------------------------------------------------ 23041286 ------------------------------------------------------------ 22974516 ------------------------------------------------------------ 22972340 ------------------------------------------------------------ 23125546 ------------------------------------------------------------ 17229920 ------------------------------------------------------------ 17232665 ------------------------------------------------------------ 22972652 ------------------------------------------------------------ 23125524 ------------------------------------------------------------ 17228319 ------------------------------------------------------------ 10957449 ------------------------------------------------------------ 23055072 ------------------------------------------------------------ 1352397 ------------------------------------------------------------ 22095655 ------------------------------------------------------------ 22095657 ------------------------------------------------------------ 22095684 ------------------------------------------------------------ 15131529 ------------------------------------------------------------ 18252319 ------------------------------------------------------------ 14572558 ------------------------------------------------------------ 18252341 ------------------------------------------------------------ 21666555 ------------------------------------------------------------ 22095685 ------------------------------------------------------------ 22095686 ------------------------------------------------------------ 20091095 ------------------------------------------------------------ 17231039 ------------------------------------------------------------ 22095654 ------------------------------------------------------------ 17646113 ------------------------------------------------------------ 17646115 ------------------------------------------------------------ 22095659 ------------------------------------------------------------ 7407123 ------------------------------------------------------------ 7547007 ------------------------------------------------------------ 15598020 ------------------------------------------------------------ 21232277 ------------------------------------------------------------ 4210924 ------------------------------------------------------------ 7652766 ------------------------------------------------------------ 4154359 ------------------------------------------------------------ 4650821 ------------------------------------------------------------ 4164161 ------------------------------------------------------------ 4138853 ------------------------------------------------------------ 20090015 ------------------------------------------------------------ 21228280 ------------------------------------------------------------ 20091382 ------------------------------------------------------------ 21229203 ------------------------------------------------------------ 21228731 ------------------------------------------------------------ 20092182 ------------------------------------------------------------ 20091132 ------------------------------------------------------------ 21227050 ------------------------------------------------------------ 20091380 ------------------------------------------------------------ 21229201 ------------------------------------------------------------ 20093164 ------------------------------------------------------------ 23052557 ------------------------------------------------------------ 23052223 ------------------------------------------------------------ 21228983 ------------------------------------------------------------ 21229307 ------------------------------------------------------------ 20090805 ------------------------------------------------------------ 20091183 ------------------------------------------------------------ 20092217 ------------------------------------------------------------ 17980436 ------------------------------------------------------------ 15641456 ------------------------------------------------------------ 1754642 ------------------------------------------------------------ 17232455 ------------------------------------------------------------ 23126551 ------------------------------------------------------------ 18030059 ------------------------------------------------------------ 2765035 ------------------------------------------------------------ 23126883 ------------------------------------------------------------ 23127256 ------------------------------------------------------------ 23125853 ------------------------------------------------------------ 17227678 ------------------------------------------------------------ 23128069 ------------------------------------------------------------ 17230934 ------------------------------------------------------------ 23124340 ------------------------------------------------------------ 23126892 ------------------------------------------------------------ 17232702 ------------------------------------------------------------ 23127009 ------------------------------------------------------------ 17228473 ------------------------------------------------------------ 23125940 ------------------------------------------------------------ 17230767 ------------------------------------------------------------ 17230584 ------------------------------------------------------------ 23126274 ------------------------------------------------------------ 17231477 ------------------------------------------------------------ 23123945 ------------------------------------------------------------ 23129209 ------------------------------------------------------------ 23125015 ------------------------------------------------------------ 17229338 ------------------------------------------------------------ 17229296 ------------------------------------------------------------ 17229208 ------------------------------------------------------------ 23125906 ------------------------------------------------------------ 23126863 ------------------------------------------------------------ 21244408 ------------------------------------------------------------ 21233072 ------------------------------------------------------------ 17549399 ------------------------------------------------------------ 21242798 ------------------------------------------------------------ 21231592 ------------------------------------------------------------ 22970619 ------------------------------------------------------------ 22972228 ------------------------------------------------------------ 23125527 ------------------------------------------------------------ 16331636 ------------------------------------------------------------ 17229180 ------------------------------------------------------------ 8953946 ------------------------------------------------------------ 22298442 ------------------------------------------------------------ 17230612 ------------------------------------------------------------ 16331796 ------------------------------------------------------------ 17231589 ------------------------------------------------------------ 23128501 ------------------------------------------------------------ 15614576 ------------------------------------------------------------ 15640642 ------------------------------------------------------------ 22986735 ------------------------------------------------------------ 23121548 ------------------------------------------------------------ 23039579 ------------------------------------------------------------ 23043880 ------------------------------------------------------------ 23039991 ------------------------------------------------------------ 23027341 ------------------------------------------------------------ 17231003 ------------------------------------------------------------ 20270658 ------------------------------------------------------------ 22297980 ------------------------------------------------------------ 17547175 ------------------------------------------------------------ 22972067 ------------------------------------------------------------ 16331345 ------------------------------------------------------------ 22297573 ------------------------------------------------------------ 585964 ------------------------------------------------------------ 22970411 ------------------------------------------------------------ 23125172 ------------------------------------------------------------ 18642520 ------------------------------------------------------------ 20090134 ------------------------------------------------------------ 23016161 ------------------------------------------------------------ 23014799 ------------------------------------------------------------ 17231259 ------------------------------------------------------------ 16079368 ------------------------------------------------------------ 22970291 ------------------------------------------------------------ 23107696 ------------------------------------------------------------ 22970589 ------------------------------------------------------------ 22972926 ------------------------------------------------------------ 22972124 ------------------------------------------------------------ 22972483 ------------------------------------------------------------ 16332022 ------------------------------------------------------------ 21397947 ------------------------------------------------------------ 20808918 ------------------------------------------------------------ 15924682 ------------------------------------------------------------ 21399214 ------------------------------------------------------------ 23099619 ------------------------------------------------------------ 23022358 ------------------------------------------------------------ 20807497 ------------------------------------------------------------ 20809032 ------------------------------------------------------------ 15614508 ------------------------------------------------------------ 23020864 ------------------------------------------------------------ 16801705 ------------------------------------------------------------ 16804538 ------------------------------------------------------------ 21673490 ------------------------------------------------------------ 15894978 ------------------------------------------------------------ 18310739 ------------------------------------------------------------ 20808059 ------------------------------------------------------------ 15643616 ------------------------------------------------------------ 15644402 ------------------------------------------------------------ 21402631 ------------------------------------------------------------ 16079962 ------------------------------------------------------------ 15615718 ------------------------------------------------------------ 23055160 ------------------------------------------------------------ 4467966 ------------------------------------------------------------ 22970541 ------------------------------------------------------------ 23054120 ------------------------------------------------------------ 2126373 ------------------------------------------------------------ 22998334 ------------------------------------------------------------ 22980684 ------------------------------------------------------------ 23110372 ------------------------------------------------------------ 22957154 ------------------------------------------------------------ 23108991 ------------------------------------------------------------ 22960787 ------------------------------------------------------------ 15887409 ------------------------------------------------------------ 3288072 ------------------------------------------------------------ 3288065 ------------------------------------------------------------ 38541207 ------------------------------------------------------------ 16762786 ------------------------------------------------------------ 79091 ------------------------------------------------------------ 16766789 ------------------------------------------------------------ 1790910 ------------------------------------------------------------ 15803908 ------------------------------------------------------------ 3402275 ------------------------------------------------------------ 16120480 ------------------------------------------------------------ 7521585 ------------------------------------------------------------ 15642707 ------------------------------------------------------------ 4433394 ------------------------------------------------------------ 23029129 ------------------------------------------------------------ 21225359 ------------------------------------------------------------ 16760444 ------------------------------------------------------------ 16764817 ------------------------------------------------------------ 15802023 ------------------------------------------------------------ 16122533 ------------------------------------------------------------ 17547782 ------------------------------------------------------------ 15596355 ------------------------------------------------------------ 23059222 ------------------------------------------------------------ 2978442 ------------------------------------------------------------ 2120819 ------------------------------------------------------------ 15888314 ------------------------------------------------------------ 17987619 ------------------------------------------------------------ 23012186 ------------------------------------------------------------ 23015154 ------------------------------------------------------------ 22967256 ------------------------------------------------------------ 16125554 ------------------------------------------------------------ 23012772 ------------------------------------------------------------ 23062762 ------------------------------------------------------------ 21244739 ------------------------------------------------------------ 21233364 ------------------------------------------------------------ 15836992 ------------------------------------------------------------ 21290140 ------------------------------------------------------------ 2772574 ------------------------------------------------------------ 154267 ------------------------------------------------------------ 16760105 ------------------------------------------------------------ 16764585 ------------------------------------------------------------ 72574 ------------------------------------------------------------ 15801326 ------------------------------------------------------------ 16129092 ------------------------------------------------------------ 4103329 ------------------------------------------------------------ 16121901 ------------------------------------------------------------ 14133540 ------------------------------------------------------------ 3237373 ------------------------------------------------------------ 15596377 ------------------------------------------------------------ 23058069 ------------------------------------------------------------ 23108708 ------------------------------------------------------------ 23105678 ------------------------------------------------------------ 23060595 ------------------------------------------------------------ 15595954 ------------------------------------------------------------ 22954643 ------------------------------------------------------------ 22956336 ------------------------------------------------------------ 22978152 ------------------------------------------------------------ 22979925 ------------------------------------------------------------ 16124493 ------------------------------------------------------------ 23008220 ------------------------------------------------------------ 15789910 ------------------------------------------------------------ 23012774 ------------------------------------------------------------ 23054444 ------------------------------------------------------------ 17548536 ------------------------------------------------------------ 23112385 ------------------------------------------------------------ 20806987 ------------------------------------------------------------ 8134668 ------------------------------------------------------------ 15607631 ------------------------------------------------------------ 23019099 ------------------------------------------------------------ 15599971 ------------------------------------------------------------ 16329335 ------------------------------------------------------------ 17158719 ------------------------------------------------------------ 17228666 ------------------------------------------------------------ 17158741 ------------------------------------------------------------ 16331909 ------------------------------------------------------------ 22002503 ------------------------------------------------------------ 16331561 ------------------------------------------------------------ 15900028 ------------------------------------------------------------ 16125984 ------------------------------------------------------------ 16120376 ------------------------------------------------------------ 21398527 ------------------------------------------------------------ 23124069 ------------------------------------------------------------ 23129374 ------------------------------------------------------------ 23126640 ------------------------------------------------------------ 17228138 ------------------------------------------------------------ 23130517 ------------------------------------------------------------ 17229043 ------------------------------------------------------------ 17229973 ------------------------------------------------------------ 23130568 ------------------------------------------------------------ 23124579 ------------------------------------------------------------ 23129091 ------------------------------------------------------------ 17230717 ------------------------------------------------------------ 23129381 ------------------------------------------------------------ 23124797 ------------------------------------------------------------ 23125086 ------------------------------------------------------------ 23125525 ------------------------------------------------------------ 17232208 ------------------------------------------------------------ 23126381 ------------------------------------------------------------ 17232179 ------------------------------------------------------------ 23130314 ------------------------------------------------------------ 17231753 ------------------------------------------------------------ 23128669 ------------------------------------------------------------ 23124502 ------------------------------------------------------------ 17228204 ------------------------------------------------------------ 17228205 ------------------------------------------------------------ 17231049 ------------------------------------------------------------ 17231183 ------------------------------------------------------------ 17227850 ------------------------------------------------------------ 17228395 ------------------------------------------------------------ 23129758 ------------------------------------------------------------ 23123961 ------------------------------------------------------------ 23054214 ------------------------------------------------------------ 15615279 ------------------------------------------------------------ 1084017 ------------------------------------------------------------ 23020725 ------------------------------------------------------------ 23023165 ------------------------------------------------------------ 15644413 ------------------------------------------------------------ 16126012 ------------------------------------------------------------ 22957099 ------------------------------------------------------------ 23106942 ------------------------------------------------------------ 15887876 ------------------------------------------------------------ 22955591 ------------------------------------------------------------ 22960563 ------------------------------------------------------------ 21302079 ------------------------------------------------------------ 17137298 ------------------------------------------------------------ 3183111 ------------------------------------------------------------ 17556919 ------------------------------------------------------------ 19526816 ------------------------------------------------------------ 13540705 ------------------------------------------------------------ 19923736 ------------------------------------------------------------ 8895958 ------------------------------------------------------------ 20071134 ------------------------------------------------------------ 12837543 ------------------------------------------------------------ 16758676 ------------------------------------------------------------ 4505689 ------------------------------------------------------------ 4885545 ------------------------------------------------------------ 20348831 ------------------------------------------------------------ 7305375 ------------------------------------------------------------ 16758318 ------------------------------------------------------------ 4505693 ------------------------------------------------------------ 12585306 ------------------------------------------------------------ 11260590 ------------------------------------------------------------ 6437541 ------------------------------------------------------------ 12039359 ------------------------------------------------------------ 3746431 ------------------------------------------------------------ 12829952 ------------------------------------------------------------ 13249142 ------------------------------------------------------------ 3695005 ------------------------------------------------------------ 18376030 ------------------------------------------------------------ 19114791 ------------------------------------------------------------ 11432626 ------------------------------------------------------------ 14602703 ------------------------------------------------------------ 15451424 ------------------------------------------------------------ 16975323 ------------------------------------------------------------ 252737 ------------------------------------------------------------ 13278573 ------------------------------------------------------------ 20843792 ------------------------------------------------------------ 22086550 --------------------------------------ADASETFAFSADINQLLSLIIN 1708316 ------------------------------------MAESQVERFTFQAEINQLMSLIIN 13812107 ----------------------------------------MIETYQFQAEINQLMSLIIN 168256 ---------------------------------------MSSETFEFQAEISQLLSLIIN 16130581 ---------------------------------------MSSETFEFQAEISQLLSLIIN 6016265 ----------------------------------------MAETFEFQAEISQLLSLIIN 12718221 --------------------------------------MATAETFEFQAEISQLLSLIIN 6979704 --------------------------------------MATAETFEFQAEISQLLSLIIN 15554354 ------------------------------------------------------------ 1170381 -------------------------------------ADAKVETHEFTAEISQLMSLIIN 7549229 ---------------------------------------------------------IIN 3401959 ----------------------------------HHHHHMASETFEFQAEITQLMSLIIN 6325016 ---------------------------------------MASETFEFQAEITQLMSLIIN 171723 ---------------------------------------MAGETFEFQAEITQLMSLIIN 1076876 --------------------------------------MSNTETFKFDWEISQLMSLIIN 19115277 --------------------------------------MSNTETFKFEAEISQLMSLIIN 9082289 ------------------------------------------------------------ 123681 ------------------------------------HGEEEVETFAFQAEIAQLMSLIIN 2194027 ------------------------------------HGEEEVETFAFQAEIAQLMSLIIN 11277141 ------------------------------------HGEEEVETFAFQAEIAQLMSLIIN 20177936 --------------------------------------EEEVETFAFQAEIAQLMSLIIN 194027 --------------------------------------EEEVETFAFQAEIAQLMSLIIN 1346320 ------------------------------------HGEEEVETFAFQAEIAQLMSLIIN 72222 --------------------------------------EEEVETFAFQAEIAQLMSLIIN 722220 ------------------------------------HGEEEVETFAFQAEIAQLMSLIIN 6680305 ------------------------------------HGEEEVETFAFQAEIAQLMSLIIN 2351110 ------------------------------------------------------------ 417155 -----------------------------------QHGEDEVETFAFQAEIAQLMSLIIN 1093929 -----------------------------------PMEEEEVETFAFQAEIAQLMSLIIN 22065017 -----------------------------------PMEEEEVETFAFQAEIAQLMSLIIN 18605741 ------------------------------------------------------------ 20882565 ------------------------------------------------------------ 16123678 -----------------------------------PMEEEEVETFAFQAEIAQLMSLIIN 6016267 -----------------------------------PMEEEEVETFAFQAEIAQLMSLIIN 13129150 -----------------------------------PMEEEEVETFAFQAEIAQLMSLIIN 1732486 -----------------------------------PMEEEEVETFAFQAEIAQLMSLIIN 17865490 ------------------------------------MEEEEVETFAFQAEIAQLMSLIIN 14270366 -----------------------------------PMEEEEVETFAFQAEIAQLMSLIIN 194033 -----------------------------------PMEEEEVETFAFQAEIAQLMSLIIN 1170383 -----------------------------------PMEEEEVETFAFQAEIAQLMSLIIN 18996805 ------------------------------------PMEEEVETFAFQAEIAQLMSLIIN 295722 ---------------------------------------EEVETFAFQAEIAQLMSLIIN 722210 ------------------------------------PMEEEVETFAFQAEIAQLMSLIIN 123668 --------------------------------------EEEVETFAFQAEIAQLMSLIIN 16123668 ------------------------------------PMEEEVETFAFQAEIAQLMSLIIN 18858873 -----------------------------------MMEDEEVETFAFQAEIAQLMSLIIN 632026 ------------------------------------------------------------ 1899173 ------------------------------------TMDEEVETFAFQAEIAQLMSLIIN 18858875 -----------------------------------MRQEEEAETFAFQAEIAQLMSLIIN 632027 ------------------------------------------------------------ 4835864 -----------------------------------MRQEEEAETFAFQAEIAQLMSLIIN 1150850 ------------------------------------------------------------ 14041148 ----------------------------------TMDEDNEVETFAFQAEIAQLMSLIIN 15628191 ------------------------------------------------------------ 20985727 ------------------------------------------------------------ 17647529 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 16123663 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 123663 ---------------------------------------EEAETFAFQAEIAQLMSLIIN 6016262 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 123664 ---------------------------------------EEAETFAFQAEIAQLMSLIIN 16123664 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352553 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352581 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352579 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2984410 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352567 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352615 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 123662 ---------------------------------------EEAETFAFQAEIAQLMSLIIN 1236625 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352599 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352601 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352607 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352617 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352597 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352591 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352603 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352605 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352609 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352611 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352555 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352563 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352565 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352573 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352595 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352559 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352571 -------------------------------------MPEEAETFAFQAEIAQXMSLIIN 2352593 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352585 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352587 -------------------------------------MPEEAETXAFQAEIAXXXSLIIN 2352583 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352589 -------------------------------------MPEEAETFAFQAEIAXXMSLIIN 2352575 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 2352619 -------------------------------------MPEEAETFAFQAEIAQLMSLIIN 29027546 -------------------------------------EEMNGETFAFQAEIAQLMSLIIN 19855062 -----------------------------------MSEEMNGETFAFQAEIAQLMSLIIN 11640609 ------------------------------------------------------------ 17559162 -------------------------------------MSENAETFAFQAEIAQLMSLIIN 2826164 ----------------------------------PMSTEPQPETFAFQAEIAQLMSLIIN 6018206 --------------------------------------------------IAQLMSLIIN 8272598 --------------------------------------------------IAQLMSLIIN 8272594 --------------------------------------------------IAQLMSLIIN 8272596 --------------------------------------------------IAQLMSLIIN 6018207 --------------------------------------------------IAQLMSLIIN 6018209 ------------------------------------------------------------ 6018208 --------------------------------------------------IAQLMSLIIN 8272604 ------------------------------------------------------------ 8272606 --------------------------------------------------IAQLMSLIIN 8272602 --------------------------------------------------IAQLMSLIIN 1066807 ------------------------------------PEAPETETFAFQAEIAQLMSLIIN 21292624 -----------------------------------MPEGPEAETFAFQAEIAQLMSLIIN 7739799 ------------------------------------------------------------ 13699184 ------------------------------------TQPAEVETFAFQAEIAQLMSLIIN 12005809 ------------------------------------TDVAEVETFAFQAEIAQLMSLIIN 6018212 --------------------------------------------------IAQLMSLIIN 8272590 ------------------------------------------------------------ 6018213 --------------------------------------------------IAQLMSLIIN 6018215 --------------------------------------------------IAQLMSLIIN 6018211 --------------------------------------------------IAQLLRLIIN 6018210 --------------------------------------------------IAQLMSLIIN 14486722 --------------------------------------------------IAQLMSLIIN 14486724 --------------------------------------------------IAQLMSLIIN 6018214 --------------------------------------------------IAQLMSLIIN 1515105 -------------------------------------QMADAETFAFQAEINQLLSLIIN 1708312 --------------------------------------MADAETFAFQAEINQLLSLIIN 15237214 -------------------------------------QMADAETFAFQAEINQLLSLIIN 217855 --------------------------------------MADAETFAFQAEINQLLSLIIN 1708314 -------------------------------------QMAEAETFAFQAEINQLLSLIIN 6729771 ----------------------------------HMAGGAETETFAFQAEINQLLSLIIN 729771 ----------------------------------------ETETFAFQAEINQLLSLIIN 477226 ----------------------------------HMAGGAETETFAFQAEINQLLSLIIN 15215642 --------------------------------------MADAETFAFQAEINQLLSLIIN 1906826 --------------------------------------MADAETFAFQAEINQLLSLIIN 1708313 --------------------------------------MADAETFAFQAEINQLLSLIIN 15241115 --------------------------------------MADAETFAFQAEINQLLSLIIN 20502888 ----------------------------------------DIETFAFQAEINQLLSLIIN 547683 ----------------------------------------DVETFAFQAEINQLLSLIIN 17547683 --------------------------------------MSDVETFAFQAEINQLLSLIIN 7417154 -------------------------------------MASETETFAFQAEINQLLSLIIN 417154 ----------------------------------------ETETFAFQAEINQLLSLIIN 5123910 -------------------------------------MATETETFAFQAEINQLLSLIIN 4204859 -------------------------------------MASETETFAFQAEINQLLSLIIN 4204861 ------------------------------------------------------------ 2982291 ------------------------------------------------------------ 625986 ------------------------------------------------------------ 123676 -------------------------------------ETPDQEVYAFNADISQLLSLIIN 16123676 ---------------------------------------PDQEVYAFNADISQLLSLIIN 7381186 --------------------------------------TAQQETYAFNADISQLLSLIIN 19908703 ----------------------------------------MAETFAFNADIQQLMSLIIN 11277136 ---------------------------------------MSTETFAFNADIRQLMSLIIN 6016264 --------------------------------------MENKETFAFNADIQQLMSLIIN 9837420 ------------------------------------------------------------ 9837422 ------------------------------------------------------------ 9837418 -----------------------------------------AEHFAFEADIQQLMGLIIN 5257484 --------------------------------------------FAFEADIQQLMGLIIN 123665 ------------------------------------------ETFAFQAEINQLMSLIIN 16123665 ----------------------------------------MTETFAFQAEINQLMSLIIN 1362545 ----------------------------------------MTETFAFQAEINQLMSLIIN 21542414 ----------------------------------------MTETFAFQAEINQLMSLIIN 1168148 ------------------------------------------------------------ 320900 ----------------------------------------MTETFAFQAEINQLMSLIIN 1236665 ----------------------------------------MTETFAFQAEINQLMSLIIN 84062 ----------------------------------------MTETFAFQAEINQLMSLIIN 16123667 ----------------------------------------MTETFAFQAEINQLMSLIIN 2735814 ------------------------------------------ETFAFQAXINQLMSLIIN 20830045 -----------------------------------PTNEGEGQDFCFQTEIAPLMALIIN 22041160 -------------------------------PEEVHLGEKEVETFAFQAEIAQLMSLIIN 20881809 ---------------------------------------EEVETFVFQAEIVQLMSLIIK 21239744 ------------------------------------IMASETETFAFQAEINQLLSLIIN 20878352 --------------------------------------EEEVETFAFQAEIAQLMSLIIN 21289472 ----------------------------------IKELREKSEKFTFQAEVNRMMKLIIN 21357739 -----------------------------------KEIREKAKKFTFQTEVNRMMKLIIN 729425 ---------------------------------------EKSEKFAFQAEVNRMMKLIIN 7294254 ----------------------------------IRELREKSEKFAFQAEVNRMMKLIIN 16041057 ----------------------------------IRELREKSEKFAFQAEVNRMMKLIIN 17865698 ----------------------------------IRELREKSEKFAFQAEVNRMMKLIIN 14327942 ----------------------------------IRELREKSEKFAFQAEVNRMMKLIIN 14714615 ----------------------------------IRELREKSEKFAFQAEVNRMMKLIIN 6015101 ------------------------------------------------AEVNRMMKLIIN 2267127 ----------------------------------IKEIREKSEKFAFQAEVNRMMKLIIN 63509 ---------------------------------------EKSEKFAFQAEVNRMMKLIIN 2119732 ----------------------------------IKEIREKSEKFAFQAEVNRMMKLIIN 119359 ----------------------------------IKEIREKSEKFAFQAEVNRMMKLIIN 14579649 ----------------------------------IKEIREKSERFAFQAEVNRMTKLIIN 17542208 ----------------------------------IKELRSKAEKHEFQAEVNRMMKLIIN 10644561 ---------------------------------------ESAEKHQFQAEVNRMVKLIIN 7673568 ------------------TKEGEAISLDGLSVEQLKQAREHAEKRQFEAEVDRMMKIIVN 5442420 ------------------------------------TLRNSAEKFEFQAEVSRLMDIIIN 544242 ------------------------------------------EKFEFQAEVSRLMDIIIN 18855040 ------------------------------------TLRSSAEKFEFQAEVSRLMDIIIN 462013 ----------------------------------MRNLRSDAEKFEFQAEVSRLMDIIIN 15233740 ------------------------------------TLRSNAEKFEFQAEVSRLMDIIIN 11277137 ----------------------------------AKLIEEKGEKFTFQTEVNKLMNIIIN 15228059 -----------------------------------TTEEGSGEKFEYQAEVSRLLDLIVH 1906830 -----------------------------------TTEEGSGEKFEYQAEVSRLLDLIVH 15628189 -------------------------------------EEAAGEKFEYQAEVSRLMDLIVH 1076758 ----------------------------------GEEEEAAGEKFEYQAEVSRLMDLIVH 15231505 ----------------------------------SSQAPPPAEKFEYQAEVSRLMDLIVN 3273568 --------------------------------------QKTSESYEFQTEVSRLMDIIIN 19880568 -------------------------------------GDGRGTPIAFQAEVSKMLDILVN 7689258 -------------------------------------GDGRGTPIAFQAEVSKMLDILVN 1708336 ---------------------------------------TNQETRGFQSEVKQLLQLMIH 16272078 ------------------------------------IMSQNQETRGFQSEVKQLLQLMIH 15602889 ---------------------------------------TNQETRGFQSEVKQLLQLMIH 16759466 ------------------------------------------ETRGFQSEVKQLLHLMIH 17865481 ------------------------------------------ETRGFQSEVKQLLHLMIH 16763867 ------------------------------------------ETRGFQSEVKQLLHLMIH 15800202 ------------------------------------------ETRGFQSEVKQLLHLMIH 16123284 ------------------------------------MNMKGQETRGFQSEVKQLLHLMIH 15641000 ------------------------------------TATTNKETRGFQSEVKQLLHLMIH 5825486 -------------------------------------------TRGFQSEVKQLLHLMIH 1708338 -----------------------------------SEQTANKETRGFQSEVKQLLHLMIH 15596793 -----------------------------------MSVETQKETLGFQTEVKQLLHLMIH 23060493 ----------------------------------TMSVETQKETLGFQTEVKQLLHLMIH 23102358 ----------------------------------TMSVDTQKETLGFQAEVKQLLHLMIH 21243261 -----------------------------------MTVETDKQTLGFQTEVKQLLQLMIH 21231830 -----------------------------------MTVDTDKQTLGFQTEVKQLLQLMIH 22995135 ------------------------------------TLEADKQTHGFQTEVKQLLQLMIH 22997683 ------------------------------------TLEADKQTHGFQTEVKQLLQLMIH 15837580 ------------------------------------TLEADKQTHGFQTEVKQLLQLMIH 23026686 -----------------------------------MTAEATVETRGFETEAKQLLHLMIH 22976164 -----------------------------------MTAPH--ETMSFQAEVKQLLHLMIH 17545709 -----------------------------------MGAPH--EKMAFQAEVKQLLHLMIH 22985781 -------------------------------------MAQ--ETMSFQAEVKQLLHLMIH 22955614 -----------------------------------MQTAENIEHLNFQAEANQLLKLMIH 23001902 -------------------------------------AATETEVREFQTEVSQLLDLMIH 15617081 ------------------------------------MKTQKKEVYNFQSETKKLLHLMIH 21672733 ------------------------------------MNIQKKEVYSFQSEVKQLLHLMIH 23015985 ---------------------------------------MAEEKRQFQAEVGKLLDIVVH 22965455 -------------------------------------PAMSEETLSFQAEVSKLLDIVVH 15893225 ---------------------------------------MIQEKKKFDAEVGKILNLMIH 15604670 ----------------------------------------TQEKKKFDAEVGKILNLMIH 23053556 ---------------------------------------MTKTTKKFETEVQQLLDLVIH 15613570 -----------------------------------------MERKEFKAESKRLLEMMVN 16081033 ------------------------------------------AKKEFKAESKRLLDMMIN 18309398 -----------------------------------------MEKREFKAESKRLLDIVIN 15896558 -----------------------------------------MAVKQFKAESKRLLDLMIN 23100613 ------------------------------------------GKRKFKAESQKLLDMVIN 19703666 ----------------------------------------------FKAETKELLNLMIH 15594905 ----------------------------------------------FDTEVNDLLYLIIH 15791880 --------------------------------------------MQFQTEVNQLLQLMIH 15611266 ---------------------------------------MSNQEYTFQTEINQLLDLMIH 15644838 ------------------------------------------QEYTFQTEINQLLDLMIH 15639968 --------------------------------------------YEFQTEVSQLLTLIIH 22961977 -----------------------------------TMTDTASETKPFQAEVAELLNLMVH 15827855 -------------------------------------MSAQVEQLEFQAEARQLLDLMVH 15609436 -------------------------------------MNAHVEQLEFQAEARQLLDLMVH 21225782 ---------------------------------------MTTETFEFQVEARQLLQLMIH 21294891 -------------------------------------VG-TSDKHEFQAETRMLLDIVAR 17137688 ----------------------------------KQASGSVVDKHEFQAETRQLLDIVAR 1082886 ----------------------------------TESVQGSTSKHEFQAETKKLLDIVAR 21752190 ---------------------------------PLHSIISSTSKHEFQAETKKLLDIVAR 13385998 ----------------------------------------SVSKHEFQAETKKLLDIVAR 13905144 ----------------------------------------SVSKHEFQAETKKLLDIVAR 17402847 ----------------------------------------EPQRHEFQAETRNLMDIVAK 21673658 -------------------------------------PTSSVREFEYKAEMKQLLNLIVH 23112245 -------------------------------------------------EIRQLLDIVIN 22974366 ------------------------------------------------------------ 13471897 ------------------------------------TDTKATETRAFEADVSRLLHMMVH 16264597 ----------------------------------MSEVETSVEKHVFEADVAKLLHLMVH 19074029 ------------------------------------IKDKHSETHGFEVDVNQMMDTMIK 22970048 ------------------------------------LTETGRQSHTFKAEVQQVLYILAH 17865477 -----------------------------------------------------IFPIIKK 17865496 -----------------------------------------------------IFPVIKK 23136628 -----------------------------------------------------IFPIIKK 16332281 -----------------------------------------------------IFPIIKK 23042149 -----------------------------------------------------IFPIIKK 22298734 -----------------------------------------------------IFPIIKK 6136879 -----------------------------------------------------IFPIIKK 23122748 -----------------------------------------------------IFPIIKK 17451483 ------------------------------------------------------------ 22041746 -------------------------------------PGAEHTSWGVAFSELCALVVGIL 20827505 -------------------------------------------SASK-----IFL----- 20848817 -----------------------------------------MVQASHPVLYYYFLGFPIK 20862694 -----------------------------------------PEMINIKENKFALFRCLEV 20855641 ------------------------------------------------------------ 20879409 ------------------------------------------------------------ 5817861 ------------------------------------------MPNNNNSHYTADNIQILE 19705416 ------------------------------------------MEEKMS--YEAQNITVLE 21397975 ----------------------------------------MEQKQMQENSYDESQIQVLE 15612569 ----------------------------------------MTREQQ---AYDESQIQVLE 16077074 ----------------------------------------MEQQQN---SYDENQIQVLE 23097461 ---------------------------------------SMEDKITENQEYGADQIQVLE 15982567 ------------------------------------TEE-EKNMRERAQEYDASQIQVLE 22991526 ------------------------------------MTE-ERSLVERAKEYDASQIQVLE 15674782 -----------------------------------MIEE-NKHFEKKMQEYDASQIQVLE 19745824 -----------------------------------MIEE-NKHFEKKMQEYDASQIQVLE 21910012 ------------------------------------------------------------ 22536796 -----------------------------------MTEE-TKNMEQRAQEYDASQIQVLE 1052804 -----------------------------------MTEE-IKNLQ--AQDYDASQIQVLE 15900699 -----------------------------------MTEE-IKNLQ--AQDYDASQIQVLE 1490397 -----------------------------------MTEE-IKNLQ--AQDYDASQIQVLE 15672887 -----------------------------------MNEE-NKNLEMLADEYDASQIQVLE 16799085 -----------------------------------MSEENITNVHESASDYNEDQIQVLE 16802054 -----------------------------------MSEENITNVQENASDYNEDQIQVLE 153085 ------------------------------------MVTALSDVNN-TDNYGAGQIQVLE 15922995 ------------------------------------MVTALSDVNN-TDNYGAGQIQVLE 23024059 ------------ENNENIDQELESVDDIITDDEE---IRHASTVDAKAGDYNADQIQVLE 23036988 ----------------------------MVDLKK---NNQVAPSDNNS--YGGSSIQILE 23003074 ----------------------------MAEDKSKAALNKAKDFEKRADTYNASQIQVLG 462227 ----------------------------------------------MGDNYNSESIQILE 16078870 ------------------------------------------------------------ 3914289 --------------------------------------------RKQQFDYNEDAIQVLE 21401521 -------------------------------------------MAKHQFQYNEDAIQVLE 15614703 ------------------------------------------MAQRQDFVYNDDAIQVLE 23099148 --------------------------------------------MTSDYQYSDSSIQVLE 15924344 ------------------------------------------MAMNKQNNYSDDSIQVLE 1709584 --------------------------------------------MNKQNNYSDDSIQVLE 15982570 ------------------------------------------MAKKINNEYNDASIQVLE 16800393 ------------------------------------------------------SIQVLE 16803326 ------------------------------------------------------SIQVLE 15900737 ------------------------------------------KKEININNYNDDAIQVLE 15902800 ------------------------------------------KKEININNYNDDAIQVLE 15672961 -------------------------------------------MVIDINNYDDSAIQVLE 15186713 ------------------------------------------------------------ 22537312 ------------------------------------MEVTLAKQDITVTNYGDDAIQVLE 15674930 ------------------------------------------------------AIQVLE 23023557 -----------------------------------------------------DSIKILE 23037924 -----------------------------------MFARILFMTKKKEISYNESDIKILE 23002511 ------------------------------------------------------------ 21708093 --------------------------------------------MAENKKYDESAIQVLE 938029 ---------------------------------------------------DESAIQVLE 1708093 ------------------------------------------------KKYDESAIQVLE 7387745 ------------------------------------------SKQEEISKYGAKNIQFLE 1170146 -----------------------------------------MDKIEEIHKYNADNIQILE 15829210 ------------------------------------------MFMSKNNQYNASNIQVLK 13507742 -----------------------------------------MEDNNKTQAYDSSSIKILE 22127614 -----------------------------------------MEDNNKTQAYDSSSIKILE 2127614 ---------------------------------------------------DSSSIKILE 12044853 -----------------------------------------MEENNKANIYDSSSIKVLE 1346241 ---------------------------------------------TKKDQYSSQSIKVLE 13357637 ------------------------------------------NDSNKEKKYTAESIKVLE 4099111 ------------------------------------------------------------ 21903715 ------------------------------------------------NNYEASDLKVLK 15828843 -----------------------------------------------MSKYTVDDLKMLK 529464 -----------------------------------------------------KHIKVLK 13358029 -----------------------------------------------ANKYDGNAIKILE 12045055 ----------------------------------------------MKSNYSATNIKILK 13507861 ------------------------------------------------NNYSEANIKILK 15894905 -----------------------------------------MNKNENIEDYDVTSLTSLE 18311051 -----------------------------------------MYMSNKNNNYDVTSLTSLE 21309845 --------------------------------------------------YSASSIEILE 18414465 --PPFSSPSPSFRLKFQLTSVLSQRLIQRNAISSRFLSTEASQETTTSKGYSSEQIQVLE 9955568 --PPFSSPSP--RLKFQLTSVLSQRLIQRNAISSRFLSTEASQETTTSKGYSSEQIQVLE 15228245 --------------------------------------MESLQESSTSKDYSSEHIQVLE 6630698 -----------------------------------------MQEKRVAGEYTAANVQVLE 19909727 ------------------------------------------------------------ 19909729 ------------------------------------------------------------ 23128092 -----------------------------------------------TSSYSADQIQVLE 17232757 ------------------------------------------------SSYSADQIQVLE 23043187 ---------------------------------------------MASNNYGAEQIQVLE 19909553 ------------------------------------------------------------ 16330312 --------------------------------------------TMTTTNYGADQIQVLE 19909557 ------------------------------------------------------------ 22298189 ----------------------------------------------------SAQLRVLK 23130837 -------------------------------------MSED---SKVQAAYGAEQIQVLE 23132789 -------------------------------------MSDA---SKVQNAYGAEQIQVLE 23123435 -------------------------------------MSEEKRSNKISNDYGADQIQVLE 13812265 -----------------------------KKFITDINNKSSLNNANSNNNYNANNITVLE 6644316 ------------------------------------------------------------ 15530000 ------------------------------------------------------------ 6644317 ------------------------------------------------------------ 6644324 ------------------------------------------------------------ 6644322 ------------------------------------------------------------ 15530563 ------------------------------------------------------------ 6644326 ------------------------------------------------------------ 6644323 ------------------------------------------------------------ 3320890 ------------------------------------------------------------ 6644148 ------------------------------------------------------------ AAN03628.1 ------------------------------------------------------------ 15551673 ------------------------------------------------------------ 2196850 ------------------------------------------------------------ 2196852 ------------------------------------------------------------ 2196854 ------------------------------------------------------------ 15551715 ------------------------------------------------------------ 15551725 ------------------------------------------------------------ 22091020 ------------------------------------------------------------ 15551717 ------------------------------------------------------------ 7407142 ------------------------------------------------------------ 15551723 ------------------------------------------------------------ 22091034 ------------------------------------------------------------ 22091026 ------------------------------------------------------------ 22091032 ------------------------------------------------------------ 22090910 ------------------------------------------------------------ 22090932 ------------------------------------------------------------ 15551675 ------------------------------------------------------------ 22091036 ------------------------------------------------------------ 16762490 ----------------------------------------------MSNSYDSSSIKVLK 1546916 ----------------------------------------------MSNSYDSSSIKVLK 22090642 ------------------------------------------------------------ 22090904 ------------------------------------------------------------ 15804293 ----------------------------------------------MSNSYDSSSIKVLK 7546302 -----------------------------------------------SNSSDSSSIKVLK 3212436 -----------------------------------------------SNSYDSSSIKVLK 15551701 ------------------------------------------------------------ 15551697 ------------------------------------------------------------ 15551685 ------------------------------------------------------------ 15551677 ------------------------------------------------------------ 19909647 ------------------------------------------------------------ 15551683 ------------------------------------------------------------ 15551693 ------------------------------------------------------------ 15551691 ------------------------------------------------------------ 15551681 ------------------------------------------------------------ 15551679 ------------------------------------------------------------ 15551695 ------------------------------------------------------------ 22091042 ------------------------------------------------------------ 22127978 ---------------------------------------------MMSNTYDSSSIKVLK 7107361 --------------------------------------------------------KVLK 15551719 ------------------------------------------------------------ 15551713 ------------------------------------------------------------ 15551711 ------------------------------------------------------------ 15551709 ------------------------------------------------------------ 15551705 ------------------------------------------------------------ 15551721 ------------------------------------------------------------ 2267054 ------------------------------------------------------------ 15603341 ------------------------------------------MSNNTPENYGANSIKVLK 15551707 ------------------------------------------------------------ 16272510 ------------------------------------------MSETTNDNYGASSIKVLK 4894891 ------------------------------------------------------------ 4894893 ------------------------------------------------------------ 6018677 ------------------------------------------------------------ 6018679 ------------------------------------------------------------ 4894892 ------------------------------------------------------------ 6456476 ------------------------------------------------------------ 4894894 ------------------------------------------------------------ 2853305 ------------------------------------------------------------ 6016182 ------------------------------------------------------------ 19909651 ------------------------------------------------------------ 2853307 ------------------------------------------------------------ 2853310 ------------------------------------------------------------ 19909659 ------------------------------------------------------------ 15640047 -----------------------------------------------------SSIKVLK 19909653 ------------------------------------------------------------ 19909655 ------------------------------------------------------------ 19909621 ------------------------------------------------------------ 19909623 ------------------------------------------------------------ 19909617 ------------------------------------------------------------ 9971293 ------------------------------------------------------------ 2267058 ------------------------------------------------------------ 2267076 ------------------------------------------------------------ 2267066 ------------------------------------------------------------ 2267072 ------------------------------------------------------------ 2267062 ------------------------------------------------------------ 2267068 ------------------------------------------------------------ 2267074 ------------------------------------------------------------ 2267078 ------------------------------------------------------------ 9802387 ------------------------------------------------------------ 2267060 ------------------------------------------------------------ 4835907 ------------------------------------------------------------ 2267080 ------------------------------------------------------------ 2267070 ------------------------------------------------------------ 2267064 ------------------------------------------------------------ 2353016 ------------------------------------------------------------ 2905610 ------------------------------------------------------------ 2353020 ------------------------------------------------------------ 2353018 ------------------------------------------------------------ 2196838 ------------------------------------------------------------ 2353024 ------------------------------------------------------------ 2905604 ------------------------------------------------------------ 2905606 ------------------------------------------------------------ 2196790 ------------------------------------------------------------ 2196812 ------------------------------------------------------------ 2196808 ------------------------------------------------------------ 2196810 ------------------------------------------------------------ 2905602 ------------------------------------------------------------ 2905608 ------------------------------------------------------------ 4894896 ------------------------------------------------------------ 2196846 ------------------------------------------------------------ 18147145 ------------------------------------------------------------ 18147173 ------------------------------------------------------------ 18147183 ------------------------------------------------------------ 18147185 ------------------------------------------------------------ 18147179 ------------------------------------------------------------ 18147177 ------------------------------------------------------------ 18147151 ------------------------------------------------------------ 18147169 ------------------------------------------------------------ 18147181 ------------------------------------------------------------ 18147143 ------------------------------------------------------------ 18147175 ------------------------------------------------------------ 18147161 ------------------------------------------------------------ 18147163 ------------------------------------------------------------ 18147157 ------------------------------------------------------------ 18147171 ------------------------------------------------------------ 18147155 ------------------------------------------------------------ 18147153 ------------------------------------------------------------ 18147159 ------------------------------------------------------------ 18147167 ------------------------------------------------------------ 18147165 ------------------------------------------------------------ 18147141 ------------------------------------------------------------ 19909605 ------------------------------------------------------------ 19909599 ------------------------------------------------------------ 19909601 ------------------------------------------------------------ 18147147 ------------------------------------------------------------ 19909595 ------------------------------------------------------------ 19909597 ------------------------------------------------------------ 13359140 ------------------------------------------------------------ 18147149 ------------------------------------------------------------ 13359144 ------------------------------------------------------------ 19909619 ------------------------------------------------------------ 23027048 -------------------------------------------MSEEQRNYDSSSIKVLK 22087113 ------------------------------------------------------------ 9971301 ------------------------------------------------------------ 9971299 ------------------------------------------------------------ 9971295 ------------------------------------------------------------ 23104602 -----------------------------------------MKVMSENQTYDSSSIKVLK 11078745 ------------------------------------------------------------ 11078719 ------------------------------------------------------------ 11078727 ------------------------------------------------------------ 11078897 ------------------------------------------------------------ 11078717 ------------------------------------------------------------ 11078715 ------------------------------------------------------------ 11078765 ------------------------------------------------------------ 11078723 ------------------------------------------------------------ 11078725 ------------------------------------------------------------ 11078751 ------------------------------------------------------------ 11078835 ------------------------------------------------------------ 15595202 --------------------------------------------MSENNTYDSSSIKVLK 6116692 --------------------------------------------MSENNTYDSSSIKVLK 23057577 -----------------------------TGPYHPDPRPSGVKALSEENTYDSSSIKVLK 19909707 ------------------------------------------------------------ 19909645 ------------------------------------------------------------ 121893 -----------------------------------------------------SSIKVLK 16121893 --------------------------------------------MSENQTYDSSSIKVLK 19909609 ------------------------------------------------------------ 19909615 ------------------------------------------------------------ 2267056 ------------------------------------------------------------ 19909607 ------------------------------------------------------------ 9971297 ------------------------------------------------------------ 4996776 ------------------------------------------------------------ BAA78433.1 ------------------------------------------------------------ 19909611 ------------------------------------------------------------ 19909531 ------------------------------------------------------------ 19909671 ------------------------------------------------------------ 13487309 ------------------------------------------------------------ 13487323 ------------------------------------------------------------ 19909723 ------------------------------------------------------------ 3550425 -----------------------------------------------MTDYDSSSIKILE 4996790 ------------------------------------------------------------ BAA78440.1 ------------------------------------------------------------ 4996818 ------------------------------------------------------------ BAA78454.1 ------------------------------------------------------------ 4996816 ------------------------------------------------------------ BAA78453.1 ------------------------------------------------------------ 4996832 ------------------------------------------------------------ BAA78461.1 ------------------------------------------------------------ 11270924 ------------------------------------------------------------ 22954054 ----------------------------------TNQPESAKKTDNSHRDYNSDSIKILK 11270928 ------------------------------------------------------------ 11270934 ------------------------------------------------------------ 11270926 ------------------------------------------------------------ 19909685 ------------------------------------------------------------ 22984295 --------------------------------------MTETNNSQPDNSYGASSIQILE 19909711 ------------------------------------------------------------ 19909715 ------------------------------------------------------------ 19909713 ------------------------------------------------------------ 19909709 ------------------------------------------------------------ 17548157 ----------------------------------MTEQQKPQSTPAESSSYGAASIQILE 19909661 ------------------------------------------------------------ 19909721 ------------------------------------------------------------ 1944019 ------------------------------------------------------------ 4996804 ------------------------------------------------------------ BAA78447.1 ------------------------------------------------------------ 4996796 ------------------------------------------------------------ BAA78443.1 ------------------------------------------------------------ 4996788 ------------------------------------------------------------ BAA78439.1 ------------------------------------------------------------ 4996798 ------------------------------------------------------------ BAA78444.1 ------------------------------------------------------------ 4996834 ------------------------------------------------------------ BAA78432.1 ------------------------------------------------------------ BAA78462.1 ------------------------------------------------------------ 19909657 ------------------------------------------------------------ 19909717 ------------------------------------------------------------ 19909683 ------------------------------------------------------------ 4996784 ------------------------------------------------------------ BAA78437.1 ------------------------------------------------------------ 4996780 ------------------------------------------------------------ BAA78435.1 ------------------------------------------------------------ 4996786 ------------------------------------------------------------ BAA78438.1 ------------------------------------------------------------ 4996800 ------------------------------------------------------------ BAA78445.1 ------------------------------------------------------------ BAA78436.1 ------------------------------------------------------------ 4996826 ------------------------------------------------------------ BAA78458.1 ------------------------------------------------------------ 4996828 ------------------------------------------------------------ BAA78450.1 ------------------------------------------------------------ BAA78448.1 ------------------------------------------------------------ 1944015 ------------------------------------------------------------ 1944017 ------------------------------------------------------------ 19909703 ------------------------------------------------------------ 12060257 ------------------------------------------------------------ 4996792 ------------------------------------------------------------ BAA78441.1 ------------------------------------------------------------ 4996808 ------------------------------------------------------------ BAA78442.1 ------------------------------------------------------------ 4996820 ------------------------------------------------------------ BAA78455.1 ------------------------------------------------------------ 4996812 ------------------------------------------------------------ BAB87066.1 ------------------------------------------------------------ BAA78451.1 ------------------------------------------------------------ 4996824 ------------------------------------------------------------ 1944013 ------------------------------------------------------------ 16272041 -----------------------------------------------------DSIQVLE 121891 -----------------------------------------------------DSIQVLE 482597 -------------------------------------------TEQKHEEYGADSIQVLE 21218915 -------------------------------------------TEQKHEEYGADSIQVLE 15676138 -------------------------------------------TEQKHEEYGADSIQVLE 21672304 ----------------------------------------------MIDTYDSSKIKILR 551761 ----------------------------------------------------SSKIKILR 15616640 ----------------------------------------------MKNIYDSSNIKILR 121892 -----------------------------------------------SNTYDSSSIKVLK 16121892 ----------------------------------------------MSNTYDSSSIKVLK 23000011 -----------------------------------MTTENAPEAQHDHSTYDSTNIKVLK 21240778 ------------------------------------TDEQNTPPTPNG-TYDSSKITVLR 21229482 ------------------------------------TDEQTTPPTPNG-TYDSSKITVLR 22993815 -----------------------------------MTEKQNTSLLSNGGIYDSSKITVLR 22996622 -----------------------------------MTEKQNTSLLSNGGIYDSSKITVLR 15836610 -----------------------------------MTEKQNTSLLSNGGIYDSSKITVLR 18916405 ------------------------------------------------------------ 15963765 -------------------------------------TDISETEAGAIAEYGADSIKVLK 15887371 -------------------------------MERVLMTETSSSEVGANAEYGADSIKVLK 17988106 ------------------------------------MSEMPEMNSEAPAEYGADSIRVLK 13474326 ------------------------------------MSDQIENTNGAEAEYGADSIKVLK 18916417 ------------------------------------------------------------ 18916420 ------------------------------------------------------------ 19979595 ------------------------------------------------------------ 19979609 ------------------------------------------------------------ 18916429 ------------------------------------------------------------ 19979613 ------------------------------------------------------------ 18916423 ------------------------------------------------------------ 18916432 ------------------------------------------------------------ 18916435 ------------------------------------------------------------ 18916441 ------------------------------------------------------------ 19979597 ------------------------------------------------------------ 22962001 --------------------------------------PSAESVHPAPAEYGAESIRVLK 18916411 ------------------------------------------------------------ 19909743 ------------------------------------------------------------ BAB87067.1 ------------------------------------------------------------ BAB87068.1 ------------------------------------------------------------ BAB87069.1 ------------------------------------------------------------ 19909745 ------------------------------------------------------------ 22965523 ----------------------------------------------TQQAYTSESIKVLK 19909763 ------------------------------------------------------------ 19909543 ------------------------------------------------------------ 19909545 ------------------------------------------------------------ 19909735 ------------------------------------------------------------ BAB87063.1 ------------------------------------------------------------ 19909737 ------------------------------------------------------------ BAB87064.1 ------------------------------------------------------------ 19909539 ------------------------------------------------------------ 1049326 --------------------------TENTEDQVPDLSTPEMTTEEAAAQYGADSIKVLK 16124415 ------------------------------------------TTEEAAAQYGADSIKVLK 19909537 ------------------------------------------------------------ 15892807 --------------------------------------MSEIEEKFNESSYGADSIKVLK 15604433 --------------------------------------MSVIEEKCNESSYSADSIKVLK 19909663 ------------------------------------------------------------ 19909665 ------------------------------------------------------------ 19909667 ------------------------------------------------------------ BAB87029.1 ------------------------------------------------------------ 19909719 ------------------------------------------------------------ BAB87055.1 ------------------------------------------------------------ 23110554 ----------------------PDSLGFSAANAYVQKMASTNENTPNTNSYGADSIKVLK 19909581 ------------------------------------------------------------ 6580765 -----------------------------------------------------GSIKVLR 19909695 ------------------------------------------------------------ 19909739 ------------------------------------------------------------ 18157438 ------------------------------------------------------------ 18157436 ------------------------------------------------------------ 22956830 ------------------------PGGTAITRAQSKGFVRMAEAARVPEEYGADSIKVLK 19909633 ------------------------------------------------------------ 18157440 ------------------------------------------------------------ 23016662 -----------------------------MMSTEPMIPNDPNASANGAEEYGAGSIQVLR 15643596 -----------------------------------------------MEKYSAESIKVLK 19909675 ------------------------------------------------------------ 19909649 ------------------------------------------------------------ 13878524 -------------------------------------------PDQTAVEYTAKDIEVLD 15606321 ---------------------------------------MKKRQSQTPQEYTAEAIKAVS 19909541 ------------------------------------------------------------ 21675071 -----------------------------------MQETDIQTAQNASTEYGATNIQVLD 21465844 ------------------------------------------------MSYDASAIRVLK 15594781 -------------------------------------------MNGRFMNYVASNIQVLK 454038 -------------------------------------------MEG-LLNYVASNIQVLK 6647532 ------------------------------------------------MSYVASNIQVLK 4033400 ----------------------------------------------------ANNITVLK 15639990 ----------------------------------------------------ASSITVLE 20090442 -----------------------------------------------------SRIQVLE 21228521 -----------------------------------------------------SHIQVLE 23050010 --------------------------------------------MSDKQVYDASHIQVLE 10644698 --------------------------------------------MAAEKTYSSKNIQVLE 11270953 -------------------------------------------MSEKNEIYDESQIQVLE 18308988 -----------------------------------------------------SQIQVLE 23020027 ----------------------------------------MQAINNEMSKYDESNIQVLE 23112429 ------------------------------------------------------------ 20806552 -----------------------------NDKIKLLDKFLEGRTMAKDETYTASQIQILE 23054293 ------------------------------------------MADELNNDYGADKIKVLE 19909691 ------------------------------------------------------------ 15790024 ------------------------------------------------------------ 19909603 ------------------------------------------------------------ 121889 -----------------------------------------------------GQIQVLE 21218890 --------------------------------------------MSQDNEYGAGQIQVLE 19909689 ------------------------------------------------------------ 15604910 -------------------------------------------MDAQEKKYDASAITVLE 3510605 ----------------------------------------------------ASVITVLE 15618195 ---------------------------------------------PKEKNYDASAITVLE 15791402 ----------------------------------------------MQENYGASNIKVLK 3695371 ------------------------------------------------------------ 15611520 -----------------------------------------------MQNYQSHSIKVLK 15645128 -----------------------------------------------MQNYQSHSIKVLK 16082085 ---------------------------------------------MTEDNYDSSQIQILE 13541372 ---------------------------------------------MTDDNYDSSQIQILE 22405936 -------------------------------------------------NYDASQIQILE 18916466 -------------------------------------------------EYGAASITILE 7437456 -----------------------------TCNLKESIQTVAAQR-KAQDEYGAASITILE 13431552 -----------------------------------------------------SAITVLE 1107468 -------------------------------TPEESIRIVAAQKKKAQDEYGAASITILE 15835080 -----------------------------------------------------DSITILE 1226021 -----------------------------------------------------DSITILE BAA78449.1 ------------------------------------------------------------ 7437446 ----------------------------PPSEPQGDASDVAAQKNNAPKEYGADSITILE 19551255 --------------------------------------------ANTEHNYDASSITILE 21322770 -----------------------PKRVRWKRLYRISSEECSLKVANTEHNYDASSITILE 6729221 ------------------------------------------------------------ 23016964 -----------------------------------------------------RSITVLE 1708090 ------------------MADSGNPNENTPSVATGEN-------GEVTGSYNASAITVLE 7437457 ------------------VADSGNPNENNPSTDTGVNDAVSTSHGDASASYDASAITVLE 322319 -------------------RASVTTYDTRTATDTRGSE---QPGHVGTASYDANAITVLD 22971553 ------------------------------------------MTSETPTTYDESQIQVLE 4033395 ---------------------------------MEKTPATGSAVAPPPVEYGTDSITKLE 6006289 --------------------------------------MSEEQNPTNNGSYSADSIQVLE 23135434 --------------------------------------MSEITEQNAAG-YSADSIQVLE 10039315 ------------------------------------------------------------ 13358822 ------------------------------------------------------------ 6939900 ------------------------------------------------------------ 13517055 ------------------------------------------------------------ 9971355 ------------------------------------------------------------ 13517033 ------------------------------------------------------------ 13517035 ------------------------------------------------------------ 13517065 ------------------------------------------------------------ 21224166 -----------------------------TAETSVPSTALLAGADRDGSNYTARHLLVLE 23017713 ------------------------PFAHPRHCRRVPVTAALTTDFHDPEEYSARHLSVLE 15805931 --------------------------------------MSFSHAAGTADDYNADQISVLE 19568163 ----------------------------------------------MTTNYSANEITVLK 16273428 ----------------------------------------------MTTNYSAQEITVLK 15602235 ----------------------------------------------MTSNYSAQEITVLK 11270949 -----------------------------------------------MATYNADAIEVLS 15600160 -----------------------------------------------MATYNADAIEVLS 23103883 ----------------------------------------------MAQTYNADAIEVLS 23060755 ------------------------------------------MATPSASSYNADAIEVLS 19717679 ---------------------------------------------MTQT-YNADAIEVLT 16130926 ---------------------------------------------MTQT-YNADAIEVLT 15803577 ---------------------------------------------MTQT-YNADAIEVLT 19909673 -----------------------------------------------------DAIEVLT 16761956 ---------------------------------------------MTQT-YNADAIEVLT 3421248 ---------------------------------------------MTQT-YNADAIEVLT 421248 ---------------------------------------------------NADAIEVLT 16120993 ---------------------------------------------MTESSYNADAIEVLS 15642428 ---------------------------------------------MTEQ-YNAGAIEVLN 23029359 -----------------------------------------------MANYSAEDIEVLT 21242463 ----------------------------------------------MNTRYNAADIEVLS 21231148 ------------------------------------------PTRCMNTRYNAADIEVLS 15837887 ----------------------------------------------MNSRYNAADIEVLT 9971917 ---------------------------------------------MAKNSYDAQAIEVLS AAG10479.1 ------------------------------------------------NSYDAQAIEVLS 22977071 ----------------------------PAADGRASHFPQNDSMASKTSQYSESSIRVLK 17545695 ------------------------------------------------PQYSEASIKVLK 22987032 -------------------------------------------TKKPNAAYSEASIKVLK 15677530 --------------------------------------------MAKNNQYSESSITVLK 15794824 --------------------------------------------MAKNNQYSESSITVLK 15888935 TNEDTVKPVKAPATAAANVPANRNVQPKPAAIAAIPTSAPPAPVSPSSDDYGASSIRVLE 15965186 -----------PADAAP---------RKPAAPAAGNEASRPAPKTSDGSDYDASAIEVLE 17989021 ----------AQPVVQP----------APSAPKPVPAAAKAPPAASGGDDYNASSIRVLE 23008007 ---------------------------------------------------DASAIEVLE 22964421 ----------FEGAPK------------------SAAPKAPAKPSGAEDGYTAADIEVLE 13471034 ---------NMDKQPQP-----VRTPARPADPLVQAAAKRPAATKDGSEGYSAADIEVLE 23014487 ----------------------------------------------------AKDIEVLE 22966144 ----------------------PCRWKRPDYSGAMSDLFQDAAAAQPADAYTARSIEVLE 7437466 ---------------------------------MSGDLLSSTPS----ETYDASSIEVLE 22960431 ---------------------------------MANDLLSGQP-----ETYDASSIEVLE 23108729 ---------------------------------MSDDLFDKLPATSAAEAYDGSAIEVLE 16126217 --------------------------PRVEPTPRPIPPPPPSKTASAPGEYSAADIEVLE 4033401 --------------------------SAHSEIVVPAVPLSSPHHHKEDSTYNASSIRILE 15892232 -------------------------------MSDLFSFNKEKKNKLVDNNYSAKDIEVLE 15604098 -------------------------------MSDLFSLNKEKKNKIVYTNYSAKDIEVLD 23001295 ----------------------------------------PAFDGAMSESYDASQIEVLE 15834657 -----------------------------------------------------ASIISLA 15605394 -----------------------------------------------------SSIISLA 23138218 ------------------------------------------------------SIRSLD 15888043 -------------------------------------------------------KMTIM 15964569 -----------------------------------------------------------M 17989371 -----------------------------------------------------------M 13476839 -----------------------------------------------------------M 22961545 -----------------------------------------------------------M 22956645 ------------------------------------------AKAGGMTLLSPKIGAARP 23010126 --------------------------------------------------TSHERSAPRA 16124948 -----------------------------------------------------------M 23015547 -----------------------------------------------------------M 23109150 ----------------------------------------------------------MR 15789473 ----------------------------------------------------------TD 23104554 ----------------------------------------------------------PA 15600139 -------------------------------------------------------MSEAP 23060778 ---------------------------------------------------------NAA 23026526 ----------------------------------------------------------MP 15804759 -----------------------------------------------------------M 5107506 ---------------------------------------------------------SHM 16763178 -----------------------------------------------------------M 16767605 -----------------------------------------------------------M 16120706 -----------------------------------------------------------M 15640372 -----------------------------------------------------------M 15602769 -----------------------------------------------------------M 22983410 ----------------------------------------------------SAATPAPR 13446680 ------------------------------------------------------PSPASR 22976701 ------------------------------------------------------TAQPNR 17547282 --------------------------------------------------------PARR 21243139 -----------------------------------------------------------M 21231736 -----------------------------------------------------------M 15837362 -----------------------------------------------------------M 22995446 -------------------------------------------------------GEVLM 15677300 ----------------------------------------------------------MS 15794549 ----------------------------------------------------------MP 22955594 -----------------------------------------------------------R 15639295 ----------------------------------------------------SMHETSYK 21401749 ---------------------------------------------------------MGK 16078768 ---------------------------------------------------------MAK 16800509 ---------------------------------------------------------MAK 16803444 ---------------------------------------------------------MAK 15614931 ---------------------------------------------------------MAK 23099087 -----------------------------------------------------------M 14577936 ----------------------------------------------------------MG 15674190 ---------------------------------------------------KQESEIIVG 22538232 --------------------------------------------------------MNLS 15675871 -----------------------------------------------------------T 14279172 -----------------------------------------------------------P 15900110 ----------------------------------------------------------MS 22991198 ----------------------------------------------------------MA 15924287 ----------------------------------------------------------MG 23002387 ----------------------------------------------------------MS 23023443 -----------------------------------------------------------M 22971740 -----------------------------------------------------------M 23112898 ------------------------------------------------------------ 15895111 -----------------------------------------------------------M 18310138 ----------------------------------------------------------MN 23021245 ----------------------------------------------------------MG 20807805 ----------------------------------------------------------MN 20089411 ------------------------------------------------------MEEQGN 21227784 ------------------------------------------------------MK--GN 23051231 ------------------------------------------------------KEAKGN 19703797 ----------------------------------------------------MILEVKMS 21674838 ---------------------------------------------------------MAS 23137831 ---------------------------------------------------------MSD 23053836 ----------------------------------HFYGMLRLPRSGIEQSLKGERCTVST 23000602 -------------------------------------------------------PVSRP 15617161 -----------------------------------------------------------M 21672810 -----------------------------------------------------------Q 15893284 -----------------------------------------------------------M 15604708 -----------------------------------------------------------M 15606703 -----------------------------------------------------------M 3914082 -----------------------------------------------------------M 15642797 -----------------------------------------------------MERCSVL 15835478 --------------------------------------------------------MSLS 15605304 ------------------------------------------------------------ 15618721 ----------------------------------------------------------MS 23124554 ---------------------------------------------------------MAS 17230547 ---------------------------------------------------------MAS 23040870 ---------------------------------------------------------MQS 16329972 --------------------------------------------------------AEKS 15806699 ---------------------------------------------------------MPT 15594556 ----------------------------------------------------------MN 21287814 -------------------------------------------------------KMDPG 17136968 ----------------------------------------------------------PG 13878583 ------------------------------------------------------MAFVAG 13591989 ------------------------------------------------------MSFVAG 4557757 ------------------------------------------------------MSFVAG 460627 ---------------------------------------------------------MSL 19112991 ------------------------------------------------------DVNSRA 11357265 -------------------------------------------------------PREPP 20146218 ----------------------------------------------------GGCAGEPP 13517948 ----------------------------------------------------------MR 17554324 --------------------------------------------TRNCDEFSKIEFSLMG 19173567 -----------------------------------------------------------M 17136970 ------------------------------------------ADTEEEPDVPPPTTALSG 3193224 ------------------------------------------ADTEEEPDVPPPTTALSG 21291966 ------------------------------------------------------TNAESS 1304121 ---------------------------------------------------------PAK 4239950 -------------------------RGACGSRGGNFPSPRGGSGVASLERAESSSTEPAK 1082696 ---------------------------------------------------------PAK 1082697 ----------------------------------------------------------AK 4885551 ------------------------------------PSPRGGSGVASLERAENSSTEPAK 22046253 ------------------------------------------------------------ 22046611 ------------------------------------------------------------ 18568033 ------------------------------------------------------------ 4239952 -----------------------------------------EGSPAMLPVQPAKLTEPAK 17942771 ----------------------------------------------------------AK 21619309 --------------------------------------PVPEADRVLHPWSELRAREPAK 17942780 ----------------------------------------------------------AK 20848664 -----------------------------------------------MEQTEGVSTECAK 6679397 -----------------------------------------------MEQTEGVSTECAK 12851890 ------------------------------------------------------------ 1082698 ----------------------------------------------------------AK 7487015 -----------------------------------------------GDSSPSPTTTSSP 172203 ------------------------------------------CKQKEQRYIPVKYLFSMT 19880897 ---------------------------------------------KEQRYIPVKYLFTMT 19880904 ---------------------------------------------KEQRYIPVKYLFTMT 19115329 ----------------------------------------------------------MS 14250028 ------------------------------------------------------------ 4505911 ------------------------------------------------------------ 20810039 ------------------------------------------------------------ 22204384 ------------------------------------------------------------ 17562796 --------------------------------------------------------MSQN 15237032 ------------------------------------------------------------ 13027781 ------------------------------------------------------------ 19074926 ------------------------------------------------------------ 12964795 ------------------------------------------------------------ 22971450 ------------------------------------------------------------ 23133974 ------------------------------------------------------------ 21229586 ------------------------------------------------------------ 19703117 ------------------------------------------------------------ 14602026 ------------------------------------------------------------ 20850207 ------------------------------------------------------------ 3023302 ------------------------------------------------------------ 15223829 ------------------------------------------------------------ 23054515 ------------------------------------------------------------ 2251101 ------------------------------------------------------------ 23107981 ------------------------------------------------------------

16081092 -----------------------------------------------------SMHLEDV 16126721 ------------------------------LALINDILDMSKIEAGKMNLKFESMHLEDV 22963829 -----------------------------------------------------PFAPRPA 22989182 ----------------------------------------------RLTIEAESIDIREL 17547798 ----------------------------------------------RLSITPAPTDLRAL 22979217 ------------------------------RQILDDVLDYAKMDAGRLRLALAPLDLRGL 23013649 -----------------------------------------------------DCDPTEL 22967281 ------------------------------LDVINDILDVSRIEAGRATLFPEPLDFAEI 22998770 ------------------------------LELINDILDLSKLEAGRIELYIQPFNLPEL 23125239 ------------------------------------------------------CNIEEL 22998928 ------------------------------LTLINDILELSRLEAGREQLQTAPFDLYEL 22999655 ------------------------------LALINQILDLSKLDAGHLQLQPEALNLHEL 22999372 ------------------------------LGIINDILDFSKIEAGKLDMENLPFLLSDT 23016213 ------------------------------LGIINDILDFSKIEAGKMTMESIDFRLEDV 23001019 ------------------------------LGIINDILDFSKIEAGKLSMESVAFYLDDV 23102095 -----------------------------LLGIINDILDFSKIEAGKMRFEQVDFQLESV 23016211 -----------------------------LLGIINDILDFSKIEAGKLEVEVTEVHLDKV 16330584 ------------------------------LGVINDILDFSKIEAGKLPMESIDFDLDKV 15641361 ------------------------------LGIINDILDFSKMEAGKLNVERIDFNLDDV 22998978 -----------------------------LLRIVDDILDFSKVEAGCLVLEETDFELESV 22998577 -----------------------------LLRIINDILDFSKIEAGKLEIEQTDFQLDDV 22999846 -----------------------------LLHIINDILDFAKVEAGKMEMEMVPFNLDEV 23000440 ------------------------------LRILNDILDFSKIEAGSLEIEKTSLKMDEV 22999533 -----------------------------LLGLIGDILDFSKIEAGKLTVESLPFTLDEM 22999650 -----------------------------LLGIINDILDVSKIEAGKLHFEDIPFKLDEL 22999289 ------------------------------LGVINDILDYSKIEAGHLVLDHVAFQLDDV 16330590 ------------------------------LGIINNILDFSKMEAGKLELEQKPFSVEEV 22998460 ------------------------------LAIINDILDFSKVEAGHLVLESIPFQPLME 22999474 -----------------------------LLAIINDLLDFSKLEAGKLALERTPFQIDEV 23000229 ------------------------------MGLLNDILDLSKIEAERMDLESQPFRLDEL 23001466 ------------------------------LALLNDVLDFSKIDAEQLALEQIPFSPTEQ 23000654 -----------------------------MLTLLNDILDFSKIEAGHLELEQSAFSPEQI 23027858 -----------------------------LLTIIDDILDLSKIEARRMVIEEIPYTLRGT 22963532 -----------------------------LLTIIDDILDLSKIEARRMVIEEIPYTLRGT 13591555 -----------------------------LLTIIDDILDLSKIEAKRMVIEEIPYTLRGT 16904238 -----------------------------LLTIIDDILDLSKIEANRMIMEEIPYTLRGT 5225252 -----------------------------LLTIIDDILDLSKIEARRMVIEEIPYTLRGT 16329802 -----------------------------LLTIIDDILDLSKIEARRMVIEEIPYTLRGT 20198952 ----------------------------SLLTIINDILDFSKIEAGRLELDQAEFSLRAH 23053202 -----------------------------LQGLINDILDLSKIEAGMLQLDSVPFSLRDC 21885294 -----------------------------LLTLLNDILDFSKIEAGKLELDPHPFSLTDL 21243225 ------------------------------LEIINDILDFSKIEAGRIDLECAPFDLNQL 21231797 -----------------------------LLEIINDILDFSKIEAGRIDLERAPFDLNQL 23102206 ------------------------------MAVINDILDYARIESGKLSLEHIEFDLEEM 15598658 ------------------------------MSVINDILDYARIESGKLHLERIDFDLEEL 23020868 ------------------------------LRVINDILDYSKIEAGKMTLENVKFDFFNL 23112091 -----------------------------LFKIINDILDFSKIEAGKLTVEEIEFNLKEV 23053622 -----------------------------LLTIINDILDFSRVEARRLELSDEALELRSF 23055398 -----------------------------LLGLLNDILDFSRIEAGRLLLEKVPFDLRNT 23020543 ------------------------------LSIINEILDFSKIEAGKLVLDNIPFNLRDL 1346440 ------------------------------LSIINEILDFSKIEAGKLVLDNIPFNLRDL 463195 ------------------------------LSIINEILDFSKIEAGKLVLDNIPFNLRDL 14906039 -----------------------------LLGIINEILDFSKIEAGKLVLDSIPFNLRDL 10178628 -----------------------------LLGIINEILDFSKIEAGKLVLDSIPFNLRDL 23059895 -----------------------------LLGIINEILDFSKIEAGKLVLDHIPFNLRDL 2439990 ------------------------------LGIINEILDFSKIEAGKLVLDSVPFNLRDL 808104 ------------------------------LGIINEILDFSKIEAGKLVLDSVPFNLRDL 13641117 ------------------------------XGIINEIXDFSKIEAGKLVLDSVPFNLRDL 15596125 -----------------------------LLGIINEILDFSKIEAGKLVLENLPFNLRDL 23102809 -----------------------------LLDIINEILDFSKIEAGKLVLEHTPFNLREL 23105439 ------------------------------LSIINDILDLSKIDSGKLVLEKTDFELEHL 23001649 -----------------------------LLTIINDILDFSKIEAGKLELEEIAFDLAEL 23027374 -----------------------------LMNIINDILDYSKIEAGKMSLEHMQFDLEEL 23026365 -----------------------------LLSVINDILDYSKVEAGKLELEHLDFDPHRL 23027857 ----------------------------SLLNLINDILDFSKVDAGKLDLEVVDFNIITL 23014385 -----------------------------LLTIINDILDFSKIEADKLQLELVELSLSEL 23015108 -----------------------------LLTVINDILDFSKMEAGKLDLDYTEFELVPL 21241265 ------------------------------LRIVDDILDYSKLEANKLELEITTFNLREL 21229958 ------------------------------LRIVDDILDYSKLEANKLELEITTFNLREL 16329648 -----------------------------LLTIINDILDFSKIEADKLVLETQAFELRPL 3955036 -----------------------------LLTIINDILDFSKIEADKLVLETQAFELRPL 23126935 -----------------------------LLSLINEILDLSKLEAGEMALETLDFDLSTC 17231253 -----------------------------LLTLINEILDLSKLEAGEMALENLNFNLSTC 17229771 ------------------------------LTIINDILDFSKIESGKLELEEQPFDLRLC 22298825 -----------------------------LLTIINDILDFSKIESGKLVLEQQPFDVREC 22298419 ------------------------------LGVINDILDFSKIESGKLELESYPFNLRTC 17230367 -----------------------------LLSIINDILDFSKIESGKLELEEQPFEVRTC 16761737 ------------------------------LAIINDVLDFSKLEAGKLILESIPFPLRNT 16766264 ------------------------------LAIINDVLDFSKLEAGKLILESIPFPLRNT 15803307 ------------------------------LAIINDVLDFSKLEAGKLILESIPFPLRST 2073556 ------------------------------LNIINDVLDFSKLEAGKLVLEDIPFSLHNT 2463029 ------------------------------LNIINDVLDFSKLEAGKLVLEDIPFSLHST 16123530 ----------------------------------------------KLILEHIPFSLRET 15642449 ------------------------------LTIINDILDFSKLEAGKLALENIPFEFQEV 23053150 ------------------------------LSLVNDLLDNSRLDAGRIHLDQIEFPFREL 23000161 ------------------------------LQIINDVLDFSRFEAGSIELFIAPLLLRQV 23000657 ------------------------------LQIINDILDISKVESGGLELQHVPFNLRRI 23026553 ------------------------------LTIINDILDFSRLEIGTLTLEYKPVKIRQL 23013889 -----------------------------LLTIINDILDYSKLESRQLKMETLPFSIIET 13472804 ------------------------------LALIEDLLDYSKIEAGRFDPEPQPMSVREI 22999284 -----------------------------LLALINDILDFSRLEAGRIELESLVVEVRPL 16124840 ------------------------------LSTINDILDFSKLESGGVSIVTAATEVNGL 16124905 ------------------------------LSVINDVLEMSKLETGQVQAHLAPCALAPL 23001602 ------------------------------LDLINDVLDLSKIEAGEFQLEHAPYDLVGL 22998518 ------------------------------LELIDDILVISQNEGAQEGEKQVVFDVDHL 22979714 ------------------------------LEILGDILDFSRIEAGEMKLEQAPIDLRLI 23012559 ------------------------------LGIINDILDFSRLEADGVQFEDAPFHLGNT 23012953 ------------------------------LGLVNDILDFSRLDAEGMTLAVEPFDVLDT 15601465 -----------------------------LLAILNDVLDYSKIEAGHLEIHHTHFDLYRL 15600175 ------------------------------LAILNEVLHFARLEEAPDVPEAVDFSLRSL 22962312 ------------------------------LALTDELLDYARIEAGKIELDCRPFVLSSL 16124282 ------------------------------STLLDDVIDISRIEAGRLDLNHEPVDPRDL 16127421 ------------------------------SALLNDIIDFSKIEAGKLELSAEPVCPAEL 16126740 ------------------------------LSVVNDVLDFSRLEAGGLELDPAPFDPAAM 16127449 ------------------------------LGVLNDVLDLSKIEAGRLEIQDRPFDIAQL 16127218 ------------------------------MTLLNDVLDISRIEAGKLEIECQPFDLPEL 16127332 ------------------------------MTILNDILDLSKIEAGKLNLEVAPFDLRKL 22998767 ------------------------------VELIEDILDLSRIEVGELELEPAPFEVEAL 23014840 ------------------------------LRILDDVLDFSKIEAGRLELEQEPVRLDRM 22954099 ------------------------------LEIIEDILDFSKIEAGRLEIEQRPISLEKV 22961592 ------------------------------LRILNDILDLSKLEAGRLEFEQADFSPTTL 22963653 ------------------------------LQILDDILDFSKLEAGRLSLEPIPFAPRNI 23000388 ------------------------------MDILNDILDLSKIEAGQLVLERAPFSPTQL 22959449 ---------------------------------------------GLVELEQVDFSIDQI 22967730 ------------------------------LSMVNDVLDFTKIEAGILDLDPVDFSVEEL 13473203 -----------------------------LLTIINDILDFSKIDAGQMVLDPAPFNLAEA 13473249 ------------------------------LTIINDILDFSKINAGQLTLDPAPFRLTEA 22958049 ------------------------------LVIINDILDYSKIEANRLTLHPEPFDLERT 21398939 ------------------------------LTLINDILDLSKVEAGKLDVIFEATNISDM 22988264 -------------------------------------------------VELETVSIDAT 13472176 -----------------------------LLSLINDILDLSKIESGTVSIDINDMPVAHL 23125110 ------------------------------LELINDILDLAKIESGTMSLDIEQIAFADL 21224094 -----------------------------LLQLINDILDLSKVDAGKMDVSPTRIALVQL 21225602 -----------------------------LLQLINDILDLSKVEAGKMDVSPERVTLRQL 23019494 -----------------------------LLQLINEILDLSKVEAGRMELNPSHVSISQL 23020660 ------------------------------LRLINDVLDLSKVESGKMNLNIFTFHSSEL 22999729 ------------------------------LRLINDILDLSKVEAGRMEVHLETVHSQEL 21242035 ------------------------------LALINDILDLSKIEAGHVELADETVVTGSV 21230642 ------------------------------LALINDILDLSKIEAGHVELSDDTVAMSSV 22998198 ------------------------------------------------------------ 23000653 ------------------------------LDVINAILDLTRIESGRLELTEERYDLHEL 23000375 ------------------------------LELINNILDISRIEEKRLTLHMAPMDLRSL 23000437 ------------------------------LDLINAILDLSKIESGRMELVEQDFDLHKM 23001024 -----------------------------LLDLINDILDLSKIEAGQLELEHAVFNPILL 22999127 ---------------------------------IDDILDLSKIEFGGLTLTREPLQPHRL 22999563 ------------------------------LDLINDILDLSRVESGRLELDHAPMHLPDF 22999905 ------------------------------LELIDNILDLSKIEAGRMTLEERAFRLDTM 23000166 ------------------------------LDLVDSILDLSRIEANQISLKQEPLNLALM 22999962 -----------------------------LLNLVNETLDLAKIEAGKLDLEYTIFDLPRL 23014204 ------------------------------LELVNSILDIAKIEAGAMTLAVQDVKLAPL 22998278 ------------------------------LSLINDILDLSKIEAGQLKLELDDFTLAET 23000401 ------------------------------LGLINDILDLSKIEAGELHLEHTLFALHDE 22999159 -----------------------------LLSLINDILDLSKIEAERLTLEHVVFDLVQL 22999727 ------------------------------LTLINDILDLSKIEEGHLSLEHTPFDLHQL 22998631 -----------------------------LLELINDVLDLSKVEADRLELEHRPFDLWAL 22998646 ------------------------------MIIINDILDLSKIEADRLELELVETDLDNL 23126479 ------------------------------LTLINDILDLSKIEAGKLELQLVPFYLPAF 23128323 ------------------------------LTLINDILDLSKIEAQRMELYKSDFHFPAF 23130312 ------------------------------LTLINDVLDLSKIEARKLELYPVDFYLPAF 17228134 ------------------------------LTLINDILDLSKIEARKLELASQAFHLPSF 23129372 ------------------------------LTLINDILDLSKLEVQKMDLYPQDFHFANF 17228884 ------------------------------LTLINDILDLAKIEAKKLELHGEDVHFPSF 23127221 ------------------------------LTLINDVLEMSKIEAGRVILSETNFDLYGL 23129844 ----------------------------------------------RITLNLNSFDLIRL 16330678 ------------------------------LELINDILEMSKIEAGRTTLNEKIIDCHRL 22298910 ------------------------------LGLINDVLDMAKIEAGRMILQQTTFDLRRM 23000906 ------------------------------MDLLNDILDLSKVQSGQIHIEVVETDIRTL 15889688 -----------------------------------------------LQVYSNEINIKDF 23011796 ----------------------------------------------------NEIRLADF 15803750 -----------------------------------------------------PVDFTSF 16131100 -----------------------------------------------------PVDFTSF 16762090 -----------------------------------------------------PVDFTSF 7212861 ----------------------------------------------RIELNRQPTDFPAL 15602178 -----------------------------------------------IELNAKAVELNSF 1122856 -----------------------------------------------------PFEPRPL 15800913 -----------------------------------------------------PFEPRPL 16120593 -----------------------------------------------------KTALLPL 21243758 -----------------------------LLRLVNDALDLARIEAGKLPLDYRDFDLRQL 21232279 -----------------------------LLRLVNDALDLARIEAGKLALDDRDFDLRQL 23121089 ------------------------------LRLVNDALDLARIESGKLELAHEPFDVRAL 21243755 -----------------------------LLRLVNDALDLARIESGRLELDFQPFSVRQL 21243756 ----------------------------------------------RLELDVEPFSVRQL 21232278 -----------------------------LLRLVNDALDLARIEAGKLELVQQPFEPSQL 23101880 -----------------------------------------------LELERTDFSLKGL 20090861 -----------------------------LLSIIDDVLDFSKIEQNKLELEQISFELESL 23135284 ----------------------------------------------KLTIEQIPFDICEV 16330151 -----------------------------------------------LVIHLEPVDLRVI 1679757 ------------------------------------------------KLKYEWFHTRSL 22086084 -----------------------------------------------LSLDLTDINIRDI 22967903 -----------------------------------------------LELEVVDFSPVEV 19115322 --------------------------------------------KMKLEPDKV-FDVEEN 23103341 -----------------------------------------------MELERIPFDLGAL 23058955 -----------------------------------------------LELEHIPFDLGSL 15599307 -----------------------------------------------LVLEMLPFELEPL 22968449 ----------------------------------------------KLHLEPHPFRLETV 15596808 ------------------------------LKVINDILDFSRIERGALELECIPFNLLEL 23059907 ----------------------------------------------ELELEHIPFNLAEV 22999065 ------------------------------------------------RFESIPYRPKQL 22999855 ------------------------------------------------VLEQIPFSPLQL 16761198 ----------------------------------------------QLKIEPREFSPREV 16765598 ----------------------------------------------QLKIEPREFSPREV 147525 ------------------------------------------------KIEPREFSPREV 15598240 ------------------------------------------------TLTPERVRLRHV 23058959 ---------------------------------------------------PERINLIDT 17231257 -----------------------------------------------LELKPELFDLTKV 4336932 ------------------------------LHLINEILDLSKIEAGKMTLYPETFEIATL 17231988 ------------------------------LELINDILDLSKIEAGKMTLYPEIFDVVTL 23041286 ------------------------------LTIINDILDLSKIEAGKMDVHWESVNIMVL 22974516 ------------------------------LTLINDILDYARLEANAVTIHPEPVHMSTL 22972340 ------------------------------LGLINDILDLAKVEAGKLELNKTNLALGPL 23125546 -----------------------------LVRLINDILDIERIESGKAKMEAEICNIVDL 17229920 ----------------------------RLVRLINDILDIERIESGRVKMERESCDLSDL 17232665 -----------------------------LVRLINDILDIERIESGKIQIAPQACNAADL 22972652 -----------------------------LLRLVNDVLDIAKIERGQLQLQRHPVAPEEI 23125524 -----------------------------LTSLINDVLDIAKMEAGKVEWQMQPLDPSEL 17228319 -----------------------------LTSLINDVLDIAKMEAGKVEWQMQPINPGEL 10957449 -----------------------------------PLLDNPAVN---------------L 23055072 ------------------------------LSLISDVLDISKIEAGQLKISPEPFQLRES 1352397 ------------------------------------------------QLELGTFNLHTL 22095655 ------------------------------------------------QLELGTFNLHTL 22095657 ------------------------------ATLINDVLDLSRLEDGSLQLDIGTFNLHAV 22095684 ------------------------------ATLINDVLDLSRLEDGSLQLDIGTFNLHAV 15131529 ------------------------------------------------QLDIATFNLHSV 18252319 ------------------------------------------------QLDIATFNLHSI 14572558 ------------------------------ATLINDVLDLSRLEDGSLQLEIATFNLHSV 18252341 ------------------------------ATLVNDVLDLSRLEDGSLQLEIATFNLHSV 21666555 ------------------------------ATLINDVLDLSRLEDGSLQLEIATFNLHSV 22095685 ------------------------------------------------QLDIGTFNLHAL 22095686 ------------------------------------------------QLDIATFNLHAV 20091095 ------------------------------------------------QLDVGTFNLHAL 17231039 ------------------------------ATLINDVLDLSRLEDGSLQLDVGTFNLHAL 22095654 ------------------------------ATLINDVLDLSRLEDGSLQLDVGTFNLHAL 17646113 ------------------------------ATLINDVLDLSRLEDGSLQLDIGTFNLHAL 17646115 ------------------------------ATLINDVLDLSRLEDGSLQLDIGTFNLHAL 22095659 ------------------------------ATLINDVLDLSRLEDGSLQLDIGTFNLHAL 7407123 ------------------------------ATLINDVLDLSRLEDGSLQLQLGTFNLHAV 7547007 ------------------------------ATLINDVLDLSRLEDGSLQLENGTFNLHAL 15598020 ------------------------------ATLINDVLDLSRLEDGILELENGTFNLHGI 21232277 ------------------------------ATLINDVLDLSRLEDGILELENGTFNLHGI 4210924 ------------------------------ATLINDVLDLSRLEDGILELENGTFNLHGI 7652766 ------------------------------ATLINDVLDLSRLEDGILELENGTFNLHGI 4154359 -------------------------------------------------LEVTVFNLHTV 4650821 -------------------------------------------------LEVTVFNLHTV 4164161 ------------------------------------------------ELDVAMFNLHDI 4138853 ------------------------------ATLINDVLDLSRLEDGSLELEMGKFNLHGV 20090015 -----------------------------------------RLELGNIELYYETVDIPGV 21228280 ------------------------------------------------ELYYETVDVAGI 20091382 ------------------------------------------------ELEYKEFELSSK 21229203 ------------------------------LNLINDILDLSKVEAGKMELDYKEFELAGK 21228731 ------------------------------------------------ELDYREFELADR 20092182 -----------------------------------------------MELNYREFDLATK 20091132 ------------------------------------------------ELKVEEFSVLDS 21227050 ------------------------------LEIINNLLDISRLEAGEKTLKYEDVDVASL 20091380 ------------------------------LNLINEILDLSKVEAGSFELHYSTFWLAEV 21229201 ------------------------------LNLINEILDLSKVEAGGFELHYSTFWLADV 20093164 ------------------------------LGLINDILDLSKVEAGKMDLHYSEFTVDSV 23052557 ------------------------------LVLINDILDLSKVEAGKMELHYSEFSIDPV 23052223 ------------------------------------------------ELNYSEFSIGSV 21228983 ------------------------------LSLINSILDLSKIEAGKMELQSDYFSLQDI 21229307 ------------------------------LTLINNILDLSKIEAGKMELEFEMFSVSEV 20090805 -----------------------------------------------------NFEFTKI 20091183 -------------------------------------------------------SVKEK 20092217 ------------------------------LEIINDILDLSKAESGEEDLNVEKFSVDES 17980436 -----------------------------------------------------KLDVAQM 15641456 -----------------------------------------RIESGHFSLHCHWLDLEKK 1754642 -----------------------------LLRLVNQLLDLQRLDAGRMQPSFRPCDLVDF 17232455 -----------------------------------------------MQPSFRPCDLVDF 23126551 -----------------------------------------------MQPSFHPCDLVEF 18030059 -----------------------------LLNLISSILDLSQIEAGRLRLVMGPVDLGSV 2765035 ------------------------------------------------SLNMAAVNLAPT 23126883 -----------------------------------------------LSLDVTPVNLLFV 23127256 ---------------------------------------------RKLSLKISSVDLSAV 23125853 ------------------------------------------------TLDITKINLKST 17227678 ------------------------------------------------VINITKVNLVTV 23128069 -----------------------------QTQLIEDLLDVSRILQGKLNLNICPVNLVMV 17230934 ------------------------------------------------SLNICPVSLPIV 23124340 ------------------------------AQLIEDLLDVSRILQGKLNLKMFPVNLVLV 23126892 -------------------------------------------------------DLKIA 17232702 -----------------------------------------------LNLNVCLVDLRNT 23127009 -----------------------------------------------LNLNFGPINLVSV 17228473 -----------------------------------------------MTLNVASVNLAAT 23125940 ------------------------------------------------TLNISSVDLAAT 17230767 ------------------------------------------------SLNIQSVNLVHT 17230584 -----------------------------------------------LSLNVCTVDLVTT 23126274 --------------------------------------------RGKLNLTFATVNLASV 17231477 ------------------------------------------------RLLVRPTKLIPV 23123945 -----------------------------------------------LRLEKRPVSLISV 23129209 ------------------------------------------------TLSFGAIDLSEP 23125015 -------------------------------------------------------NLISV 17229338 ------------------------------------------------------VNLITV 17229296 -----------------------------------------------------TCNLIPI 17229208 ---------------------------------------------------AQEVELIPV 23125906 -------------------------------------------------------DLVEV 23126863 -----------------------------LAQLIEDVLDVSRIIRGTLHLSIHRIKLVPL 21244408 -------------------------------------------------------DLVEQ 21233072 ---------------------------------------------GKVQLEVESLDLAEQ 17549399 --------------------------------------------------EIGPVDLADV 21242798 --------------------------------IIDDLLDMSAILSGKIRLQAEHFDIAGL 21231592 --------------------------------IIDDLLDMSAILSGKIRLQPEHFDIAGL 22970619 -----------------------------------------------MELDLTPVSVQDV 22972228 --------------------------------------------ANRIELVKEVVAASDV 23125527 -------------------------------------------------LLLSPLPVSDL 16331636 -----------------------------------------------------QVAVEDL 17229180 ------------------------------LDMINDILDLSQIEAGKTVLNIAEFSLVKI 8953946 ------------------------------LELINDILDLSQIEAGKAALQVRPFSLSRL 22298442 -----------------------------------------------SQLHRSAFSIRQL 17230612 -----------------------------LLDLINDILDVAKIEAGQIKLDCTTISVANL 16331796 ------------------------------LSLINDILDLSKIEAGRMDLDLNPTSVSAL 17231589 ------------------------------LELINDILDLSKIESGKLELQISDVSVRSI 23128501 ---------------------------------------------------------PEL 15614576 -------------------------------------------------LTKQPTNLLAA 15640642 --------------------------------------DYHKMRYGALDIQRCAVDLSSA 22986735 --------------------------------------------SGSIELRRQAVTLKAV 23121548 ------------------------------------------------QLHIVCLDVHQV 23039579 ------------------------------------------------KLQISSVGMREV 23043880 -----------------------------LANLVNDILDFSKLRHHSIKLKMSSVGMREV 23039991 -----------------------------LSNLVNDILDFSKIRYHKLELQVRAIDVRIV 23027341 ----------------------------RLAGLVDDLLDFAQLKHRGMALNKKAVDIHVL 17231003 -----------------------------LTRLVNDVLDLSKLESGRSYS-FDGVDLAQA 20270658 -----------------------------LTRLVNDVLDLSRLESNRRYN-FEGIDLVQP 22297980 -----------------------------LTRLVNDFLDISRLESGRPYQ-FGSVQMAQV 17547175 --------------------------------------------------------LGEV 22972067 ------------------------------MRLISDILEFSRMEAGQLIIDIEPVPVSVI 16331345 ------------------------------------------------------LAIADL 22297573 ------------------------------------------------QIMARQLDLRQL 585964 -----------------------------------------------------EVVFEPL 22970411 -----------------------------------------------------QVNLVGL 23125172 --------------------------------------------------------VETA 18642520 -------------------------------------------KVDMQASAFQLTEVETP 20090134 ------------------------------RMQSLINDLLEFSRVTTKAREFEPTDCESI 23016161 ------------------------------------------------------VSLGGV 23014799 -----------------------------------------------MEEELQPVPLDEV 17231259 ------------------------------------------------------------ 16079368 ------------------------------------------MESGHTGLHYEKINVNEF 22970291 --------------------------------------------AGQLPLYREVVSPQML 23107696 ------------------------------------------------------------ 22970589 ------------------------------------------------VLQRQPVSLPSF 22972926 --------------------------------LVDELHELSRLESGRVSLKLEPLPVWPV 22972124 -------------------------------------------------------DLLPV 22972483 -----------------------------LRRLTDDLQQLSRVESRQITLAPTPVDPAHL 16332022 ----------------------------------------------------QPLDLYPL 21397947 --------------------------------------------------MKEWVDFTDF 20808918 --------------------------------------------------NRTEFDINEL 15924682 -------------------------------------------------LDTDYMNLSDL 21399214 -------------------------------------------EGEHFPLQKQPIVFSQL 23099619 -----------------------------------------RLEREDFRLLIDNYDVRQM 23022358 ------------------------------------------------KWDMQKISFEDL 20807497 --------------------------------------------DRSIKLERESFDLKEI 20809032 -----------------------------MTRLVKDLLLLSKMDSEENSLKLEPCDFNEI 15614508 -----------------------------------------------------PIAFAQL 23020864 ----------------------------------------------------EYFDLSRL 16801705 -----------------------------------------RIEQNPVAENTEPVDVDEV 16804538 -----------------------------------------RIEQNPVPENVELVEVDEV 21673490 -----------------------------------------RIESGKIAYSFEPVDVKPQ 15894978 ----------------------------------------------------EEFDVNEI 18310739 ---------------------------------------------QKRSTILEEFNVDEE 20808059 -----------------------------------------------------KIEMDKE 15643616 ------------------------------------------------QINREKVDLCDL 15644402 --------------------------------------------------EMKDVDLCEV 21402631 -----------------------------MQGLIEDLLDLSKIEQQGFKLSMGTVDMKGL 16079962 -----------------------------LQSLVQDLLDLSKIEQQNFTLSIETFEPAKM 15615718 -------------------------------------------------LNWQQTNLFAV 23055160 -----------------------------LAALIGDLLTLSQLEAGSMNLEKTTVRPEQV 4467966 --------------------------------------TLADAAA--------------- 22970541 -----------------------------LARQIQDLLDVSRIAAGGLRLERSDVALHLL 23054120 -----------------------------------------------LKLERVPIELEDL 2126373 -----------------------------------------------------DLV---- 22998334 ------------------------------------------GMESGESYETIDLN---- 22980684 ------------------------------------------RDDAAGPRQRVDVL---- 23110372 ------------------------------------------------PVEPTELS---- 22957154 --------------------------------------------------EEVDPL---- 23108991 --------------------------------------------GSRLPAERVDVA---- 22960787 ------------------------------------------------APTLIDLA---- 15887409 ----------------------------------------------EEHMSRLPLS---- 3288072 -------------------------------------------PAGTLPQLATDIS---S 3288065 -------------------------------------------PAGTLPQLATDIS---S 38541207 -------------------------------------------TGQEMPMEMADLN---S 16762786 -------------------------------------------TGQEMPMEMADLN---S 79091 -------------------------------------------TGQEMPMEMADLN---S 16766789 -------------------------------------------TGQEMPMEMADLN---S 1790910 -------------------------------------------TGQEMPMEMADLN---S 15803908 -------------------------------------------TGQEMPMEMADLN---A 3402275 -------------------------------------------TGQEMPTEPSDLN---A 16120480 -------------------------------------------TGQEMPTEPSDLN---S 7521585 -------------------------------------------AGQNMPLTCCDLN---E 15642707 -------------------------------------------PVNREAFEAVDLN---D 4433394 -------------------------------------------PVNREAFEAVDLN---D 23029129 ------------------------------------------------------------ 21225359 ------------------------------------------GDVSDESTEVLDFADVVA 16760444 ------------------------------------------------------------ 16764817 ------------------------------------------------------------ 15802023 ------------------------------------------------------------ 16122533 ------------------------------------------------------------ 17547782 ------------------------------------------------------------ 15596355 ------------------------------------------ELGVLVRQVV-------- 23059222 ------------------------------------LTFQRIDLDALVNQVI-------- 2978442 ------------------------------------------------------------ 2120819 ------------------------------------------------------------ 15888314 ------------------------------------------------------------ 17987619 -----------------------------------------------------PVT---- 23012186 ------------------------------------------------------VE---- 23015154 ------------------------------------------------------------ 22967256 ------------------------------------------------------------ 16125554 ---------------------------------------------------ETAPL---- 23012772 ------------------------------------------------------------ 23062762 ------------------------------------------------------------ 21244739 -----------------------------------------------------PIE---- 21233364 -----------------------------------------------------PIE---- 15836992 --------------------------------------------------APVLIN---- 21290140 ------------------------------------------------------------ 2772574 -------------------------------------------SGVLLSRELHPVA---- 154267 -------------------------------------------SGVLLSRELHPVA---- 16760105 -------------------------------------------SGVLLSRELHPVA---- 16764585 -------------------------------------------SGVLLSRELHPVA---- 72574 -------------------------------------------------RELHPVA---- 15801326 ---------------------------------------------TLLSRELHPVA---- 16129092 ---------------------------------------------TLLSRELHPVA---- 4103329 ------------------------------------------AEHNLLIREVHSVP---- 16121901 ------------------------------------------SEHNVLGREIHSVP---- 14133540 ------------------------------------------SEHNVLGREIHSVP---- 3237373 ------------------------------------------GDNNLMLREISSVP---- 15596377 -------------------------------------------------RHREQLA---- 23058069 ------------------------------------------------------------ 23108708 ------------------------------------------------------------ 23105678 -----------------------------------------------GGAEPVELG---- 23060595 ------------------------------------------------------------ 15595954 --------------------------------------------------ERIDLT---- 22954643 ------------------------------------------------------------ 22956336 ------------------------------------------------------------ 22978152 ----------------------------------------------PAPAESISVR---- 22979925 ---------------------------------------------LPVQADPALLR---- 16124493 -----------------------------------------HPKALDLGRLLTEVVS--- 23008220 -------------------------------------------------RTVSTVAV--- 15789910 ------------------------------------------------------------ 23012774 ------------------------------------------------------------ 23054444 -------------------------------------------AEQRIEPIPLDMRG--- 17548536 ------------------------------------------------------MR---- 23112385 ------------------------------------------------RPYLTQVNLSAL 20806987 --------------------------------------------DKIKSPRIKRVEVSEV 8134668 -------------------------------------------QGAERLPNMTDVDVDTI 15607631 -------------------------------------------QGAERLPNMTDVDVDTI 23019099 -----------------------------------------------PLSEPVEVAVDTV 15599971 -------------------------------------------------EQFHPVNLATL 16329335 ------------------------------------------------------------ 17158719 ----------------------------------------------------DICCLDDI 17228666 ----------------------------------------------------EVCCLNDI 17158741 -------------------------------------------------TQQVHCCLNIL 16331909 ------------------------------------------------PTQFTLCCLNDL 22002503 --------------------------------------------GLQQPAPIQNLDLDAL 16331561 -------------------------------------------------------PLDAL 15900028 ------------------------------------------------TTSKDSIFLDKL 16125984 ------------------------------------------------------------ 16120376 ------------------------------------------------------------ 21398527 --------------------------------------------SNQIEMDKKIFELDKL 23124069 ---------------------------------------------------MKEVDIHEG 23129374 ---------------------------------------------------MKAVNIHEG 23126640 ---------------------------------------------------FKAVDIHEG 17228138 ---------------------------------------------------FKAVDIHEG 23130517 ---------------------------------IRQIVLSLRNFSRIDEAEFKSVDIHEG 17229043 -------------------------------------------------SEFKAVDIHEG 17229973 ---------------------------------------------------FKAVDIHAG 23130568 --------------------------------------------------EIKAVNIHEG 23124579 ---------------------------------ITEIVLSLRNFSRLDETEMKAVNIHEG 23129091 --------------------------------RICEIVTSLRNFSRLDEADFKPANIHEG 17230717 ---------------------------------IREIVLSLRNFSRLDEAEFKQVDIHEG 23129381 --------------------------------RIGEIVLSLRNFSRLDQAQVKPVDIHEG 23124797 ---------------------------------------------------NKRVDLHEG 23125086 ---------------------------------------------------FKTADLHEG 23125525 ---------------------------------------------------MKAVNIHDG 17232208 ---------------------------------------------------IKQVDIHEG 23126381 ------------------------------------------------ESEMKPVDIHEG 17232179 ------------------------------------------------ESDMKPVDIHEG 23130314 --------------------------------RISQLVLSLRSFSRLDETGMKPVDLHEG 17231753 ------------------------------------------------ET--KMVNLHEG 23128669 ------------------------------------------------EL--KAVDIHDG 23124502 --------------------------------------------------DVKAVNIHEG 17228204 -----------------------------------------------------PFNLHEG 17228205 --------------------------------RLENISTSLRTFSRADKDYKVKFNLHEG 17231049 ------------------------------------------------------FNVHEG 17231183 --------------------------------RLKNISTSLRTFSRADKDYKIPFNIHKG 17227850 -----------------------------------------------------PFNIHEG 17228395 --------------------------------------------------QKQPFNLHEG 23129758 -----------------------------------------------------PFDIHEG 23123961 --------------------------------------------------EMKSVNLHEG 23054214 --------------------------------RVRKIVADLKSFSRVDEAEYKVVDLTEC 15615279 ------------------------------------------------------------ 1084017 -----------------------------------------------------TADVAEV 23020725 --------------------------------------------------NLSSLVKNVV 23023165 ------------------------------------------------------------ 15644413 ------------------------------------------------------------ 16126012 ------------------------------------------------------------ 22957099 --------------------------------------------------------TATE 23106942 ------------------------------------------------PMLQTVIAPFDV 15887876 --------------------------------------------TGSMKARMTSVPLNEL 22955591 ------------------------------------------------------------ 22960563 -----------------------------------------------------------A 21302079 --------------------------------------------GRHIGSIDPLCDPHMV 17137298 --------------------------------------------GRHIGCLDPACDLSDV 3183111 --------------------------------------------PRHIGCIDPGCDVESV 17556919 --------------------------------------------PRHVGCIDPACDVESV 19526816 --------------------------------------------PKHIGSIDPNCSVSDV 13540705 --------------------------------------------PKHIGSIDPNCSVSDV 19923736 --------------------------------------------PKHIGSIDPNCNVSEV 8895958 --------------------------------------------PKHIGSIDPNCSVSDV 20071134 --------------------------------------------RKHIGSINPNCDVVEV 12837543 ---------------------------------------------KHIGSINPNCDVVEV 16758676 --------------------------------------------RKHIGSINPNCDVVEV 4505689 --------------------------------------------RKHIGSINPNCNVLEV 4885545 --------------------------------------------PKHIGSIDPTCNVADV 20348831 --------------------------------------------PKHIGSIDPTCNVADV 7305375 --------------------------------------------PSHIGSIDPNCDVVAV 16758318 --------------------------------------------PSHIGSIDPNCDVVAV 4505693 --------------------------------------------PSHIGSIDPNCDVVAV 12585306 --------------------------------------------PSHIGSIDPKCDVVAV 11260590 -------------------------------------------PLHTVGYIHTKMSPMEV 6437541 -------------------------------------------PLHTVGYIHTKMSPMEV 12039359 --------------------------------------------PGVIGLISKRLSPMLV 3746431 --------------------------------------------PGVIGLINTKMSPMTV 12829952 --------------------------------------------PGVIGLINTELSPIQV 13249142 --------------------------------------------PGVIGLINTELSPIQV 3695005 --------------------------------------------PGVIGLINTRLSPIQV 18376030 --------------------------------------------PSYVGIICTKTYVKDL 19114791 --------------------------------------------ENYVGVISTRANIYQI 11432626 --------------------------------------------PDFVGIICTRLSPKKI 14602703 --------------------------------------------PDFVGIICTRLSPKKI 15451424 --------------------------------------------PDFVGIICTRLSPKKI 16975323 --------------------------------------------PDFVGIICTRLSPKKI 252737 --------------------------------------------PDFVGIISTRLSPKKI 13278573 --------------------------------------------PDFVGIICTRLSPKKI 20843792 --------------------------------------------PDFVGIICTRLSPKKI 22086550 TFYSNKDVFLRELISNASDALDKIRYQS-LTDPS--VLDSDK--------DLE-IKVIPD 1708316 TFYSNKEVFLRELISNASDALDKIRYQS-LTDAS--VLESKT--------ELE-IKIIPD 13812107 TFYSNKEIFLRELISNASDALDKIRYQS-LTDSS--VLDNEP--------KLE-IRILTD 168256 TVYSNKEIFLRELISNFSDALDKIRYKA-LSDPS--KLESDK--------DLR-IDITPD 16130581 TVYSNKEIFLRELISNFSDALDKIRYKA-LSDPS--KLESDK--------DLR-IDITPD 6016265 TVYSNKEIFLRELVSNASDALDKIRYES-LSDPS--KLDTGK--------DLR-IDIIPD 12718221 TVYSNKEIFLRELISNASDALDKIRYES-LSDPS--KLDSCK--------DLR-IDIIPD 6979704 TVYSNKEIFLRELISNASDALDKIRYEVPCSDPS--KPGLLQ--------DHSSIDIIPD 15554354 ------------------------------------------------------------ 1170381 TVYSNKEIFLRELISNASDALDKIRYQA-LSDPS--QLESEP--------ELF-IRIIPQ 7549229 TVYSNKEIFLRELISNASDALDKIRYQA-LSDPS--QLESEP--------ELF-IRITPH 3401959 TVYSNKEIFLRELISNASDALDKIRYKS-LSDPK--QLETEP--------DLF-IRITPK 6325016 TVYSNKEIFLRELISNASDALDKIRYKS-LSDPK--QLETEP--------DLF-IRITPK 171723 TVYSNKEIFLRELISNASDALDKIRYQA-LSDPK--QLETEP--------DLF-IRITPK 1076876 TVYSNKEIFLRELISNASDALDKIRYQS-LSDPH--ALDAEK--------DLF-IRITPD 19115277 TVYSNKEIFLRELISNASDALDKIRYQS-LSDPH--ALDAEK--------DLF-IRITPD 9082289 ------------------------------------------------------------ 123681 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELK-IDILPN 2194027 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELK-IDIIPN 11277141 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELK-IDIIPN 20177936 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELK-IDIIPN 194027 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELK-IDIIPN 1346320 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELK-IDIIPN 72222 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELK-IDIIPN 722220 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELK-IDIIPN 6680305 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELK-IDILPN 2351110 -------------------ALDKIRYES-LTDPS--KLDSGK--------ELK-IDIIPN 417155 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDTGK--------DLK-IDIVPN 1093929 TFYSNKEIFLRELISNSSDALDKIWYES-LTDPS--KLDSGK--------ELH-INLIPN 22065017 TFYSNKEIFLRELISNSSDALDKIWYES-LTDPS--KLDSGK--------ELH-INLIPN 18605741 ------------------------------------------------------------ 20882565 ------------------------------------------------------------ 16123678 TFYSNKEIFLRELISNSSDALDKIRYET-LTDPS--KLDSGK--------ELH-INLIPN 6016267 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------ELH-INLIPN 13129150 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------ELH-INLIPN 1732486 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------ELH-INLIPN 17865490 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------ELH-INLIPN 14270366 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------ELH-INLIPN 194033 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------ELH-INLIPS 1170383 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------ELH-INIIPN 18996805 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------DLK-INLIPN 295722 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSG---------DLK-INLIPN 722210 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------DLK-INLIPN 123668 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------DLK-INLIPN 16123668 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------DLK-INLIPN 18858873 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSCK--------DLK-IELIPD 632026 --YSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSCK--------DLK-IELIPD 1899173 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPT--KLDSCK--------ELK-IEVTPD 18858875 TFYSNKEIFLRELVSNASDALDKIRYES-LTDPT--KLDSGK--------DLK-IDIIPN 632027 --YSNKEIFLRELVSNASDALDKIRYES-LTDPT--KLDSGK--------DLK-IDIIPN 4835864 TFYSNKEIFLRELISNASDALDKIRYES-LTDPT--KLDNGK--------ELK-IDVIPN 1150850 --YSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------DLK-IDIIPN 14041148 TFYSNKEIFLRELISNSSDALDKIRYQS-LTDPT--KLDNCK--------DMK-MEIIPN 15628191 -----------------------------LTDPT--KLDSGK--------DPK-IEIIPN 20985727 ------------------------------------------------------------ 17647529 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 16123663 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 123663 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 6016262 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 123664 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 16123664 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352553 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352581 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352579 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2984410 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352567 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352615 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 123662 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 1236625 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352599 TFYSNKEIFLRELISNXSDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352601 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--XLDSGK--------ELY-IKLIPN 2352607 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGX--------ELY-IKLIPN 2352617 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352597 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352591 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352603 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352605 TFYSNKEIFLRELISNASDALDKIRYEX-LXDPS--XXDSGK--------ELY-IKLIPN 2352609 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KXDXXK--------ELY-IKLIPN 2352611 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSXX--------XLY-IKLIPN 2352555 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352563 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352565 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLXSGK--------ELY-IKLIPN 2352573 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352595 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352559 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352571 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KXDSGK--------ELY-IKLIPN 2352593 TFYSNKEIFLRELISNASDALDKIRYXS-LTDPS--KXDSGK--------ELY-IKLIPN 2352585 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352587 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352583 TFYSNKEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-XKLIPN 2352589 TFYSNXEIFLRELISNASDALDKIRYES-LTDPS--KLDSGK--------ELY-IKLIPN 2352575 TFYSNKEIFLRELISNASDALDKIRYXS-XTDPX--KLXXXX--------XXX-XXXIPN 2352619 TFYSNKEIFLRELISNASDALDKIRYXS-LTDPX--KXDSGK--------ELY-IKLIPN 29027546 TFYSNKEIFLRELISNSSDALDKIRYQA-LTEPA--ELETGK--------ELY-IKITPN 19855062 TFYSNKEIFLRELISNSSDALDKIRYQA-LTEPA--ELETGK--------ELY-IKITPN 11640609 ------------------------------------------------------------ 17559162 TFYSNKEIYLRELISNASDALDKIRYQA-LTEPS--ELDTGK--------ELF-IKITPN 2826164 TFYSNKEIFLRELISNASDALDKARYMS-LTNSS--VFDTGD--------DLY-IKLIPN 6018206 TFYSNKEIFLRELISNASDALDKIRYES-LTDPT--KLDNGK--------DLF-IKIIPD 8272598 TFYSNKEIFLRELISNASDALDKIRYES-LTDST--KLDSGK--------DLF-IKIIPN 8272594 TFYSNKEIFLRELISNASDALDKIRYES-LTDPT--KLDTGK--------DLF-IKIVPD 8272596 TFYSNKEIFLRELISNASDALDKIRYES-LTDPT--KLDTGK--------ELF-IKIVPD 6018207 TFYSNKEIFLRELISNASDALDKIRYES-LTDTT--KLDTGK--------ELF-IKIIPD 6018209 ------------------------------------------------------------ 6018208 TFYSNKEIFLREIISNASDALDKIRYES-LTDPS--KLDTGK--------ELY-IKLIPD 8272604 ------------------------------------------------------------ 8272606 TFYSNKEIFLREIVSNASDALDKIRYES-LTDPS--KLDTGK--------ELY-IKIVPD 8272602 TFYSNKEIFLREIVSNASDALDKIRYES-LTDPS--KLDTGK--------ELY-IKIVPD 1066807 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPT--KLDSGK--------ELF-IKIIPN 21292624 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLESGK--------ELF-IKIIPN 7739799 ------------------------------------------------------------ 13699184 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------ELY-IKIIPN 12005809 TFYSNKEIFLRELISNSSDALDKIRYES-LTDPS--KLDSGK--------ELY-IKIIPN 6018212 TFYSNKEIFLRELISNASDALDKIRYES-LTDPH--KLDSGK--------ELY-IKIIPD 8272590 ------------------------------------------------------------ 6018213 TFYSNKEIFLRELVSNASDALDKIRYES-LTDPH--KLDSGK--------ELY-IKIIPD 6018215 TFYSNKEIFMRELISNASDALDKIRYES-LTDPH--KLDSGK--------ELY-IKIIPD 6018211 TFYSNKEIFLRELISNASDALDKIRYEA-LTDPH--KLDSGK--------ELY-IKIIPD 6018210 TFYSNKEIFLRELISNASDALDKIRYQS-LTDPC--KLDSCR--------VLE-IKIVPD 14486722 TFYSNKEIFLRELISNASDALDKIRYQS-LTDPS--KLDSCR--------DLL-IKIVPD 14486724 TFYSNKEIFLRELISNASDALDKIRYQS-LTDPS--KLDSCR--------DLV-IKIVPD 6018214 AFYSNKEIFLRELISNASDALDKIRYES-LREPS--VLDSGK--------DLE-IKIIPN 1515105 TFYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLDGQP--------ELF-IRLVPD 1708312 TFYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLDGQP--------ELF-IRLVPD 15237214 TFYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLDGQP--------ELF-IRLVPD 217855 TFYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLDGQP--------ELF-IRLVPD 1708314 TFYSNKEIFLRELISNASDALDKIRFES-LTDKS--KLDAQP--------ELF-IRLVPD 6729771 TFYSNKEIFLRELISNASDALDKIRFES-LTDKS--NVNAQP--------ELF-IRLVPD 729771 TFYSNKEIFLRELISNASDALDKIRFES-LTDKS--NVNAQP--------ELF-IRLVPD 477226 TFYSNKEIFLRELISNASDALDKIRFES-LTDKS--KLDAQP--------ELF-IRLVPD 15215642 TFYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLDGQP--------ELF-IHIIPD 1906826 TFYSNLEIFLRELISNSSDALDKIRFES-LTDKS--KLDGQP--------ELF-IHIIPD 1708313 TFYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLDGQP--------ELF-IHIIPD 15241115 TFYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLDGQP--------ELF-IHIIPD 20502888 TFYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLEAQP--------ELF-IHIIPD 547683 TFYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLDGQP--------ELF-IHIIPD 17547683 TFYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLDGQP--------ELF-IHIIPD 7417154 TFYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLDAQP--------ELF-IHIVPD 417154 TFYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLDAQP--------ELF-IHIVPD 5123910 TSYSNKEIFLRELISNSSDALDKIRFES-LTDKS--KLDAQP--------ELF-IHIIPD 4204859 TSYSNKEIFLRELISNASDALDKIRFES-LTDKS--KLDAQP--------ELF-IRIIPD 4204861 ------------------------------------------------------------ 2982291 --------------SNSSDALDKIRFES-LTDKS--KLDAQP--------ELF-IHIIPD 625986 ------------------------------------------------------------ 123676 AFYSNKEIFLRELISNASDALEKIRYEA-IKDPK--QIEDQP--------DYY-IRLYAD 16123676 AFYSNKEIFLRELISNASDALEKIRYEA-IKDPK--QIEDQP--------DYY-IRLYAD 7381186 AFYSNKEIFLRELISNASDALEKIRYEA-IKDPK--QVEDFP--------EYQ-ISLSAD 19908703 TFYSNKEIFLRELISNASDALDKIRYES-ITDPE--KIEAQP--------NFF-IKIIPD 11277136 TFYSNKEIFLRELISNASDALDKIRYES-ITDTQ--KLSAEP--------EFF-IRIIPD 6016264 TFYSNKEIFLRELISNASDALDKIRYEA-ITEPE--KLKTKP--------ELF-IRLIPD 9837420 -------IFLRELISNASDALDKIRYKS-ITDPDSAGLNVEP--------NFK-IKIVPD 9837422 -------IFLRELISNASDALDKIRYKS-ITDPDSAGLNIEP--------NFK-IKIVPD 9837418 TFYSNKEIFLRELISNASDALDKIRYIS-ITDSERAKLETEP--------NFR-IRIIPN 5257484 TFYSNKEIFLRELISNASDALDKIRYIS-ITDSEKAKLEVEP--------NFR-IRIIPD 123665 TFYSNKEIFLRDVISNASDACDKIRYQS-LTDPS--VLGDAT--------RLC-VRVVPD 16123665 TFYSNKEIFLRDVISNASDACDKIRYQS-LTDPS--VLGDAT--------RLC-VRVVPD 1362545 TFYSNKEIFLRELISNASDACDKIRYQS-LTDPS--VLGESP--------RLC-IRVVPD 21542414 TFYSNKEIFLRELISNASDACDKIRYQS-LTDPS--VLGESP--------RLC-IRVVPD 1168148 ---------------------------S-LTDPA--VLGEET--------HLR-VRVVPD 320900 TFYSNKEIFLRELISNSSDACDKIRYQS-LTNQS--VLGDEP--------HLR-IRVIPD 1236665 TFYSNKEIFLRELISNSSDACDKIRYQS-LTNQS--VLGDEP--------HLR-IRVIPD 84062 TFYSNKEIFLRELISNSSDACDKIRYQS-LTNQA--VLGDES--------HLR-IRVVPD 16123667 TFYSNKEIFLRELISNSSDACDKIRYQS-LTNQA--VLGDES--------HLR-IRVVPD 2735814 TFYSNKEIXLRELISNSSDACANPVPES--DDQS--VLGDDP---------LA-SR-NPD 20830045 TFYFNKEIFLRKLISNSSDALDKLRYDS-LMDPS--KLYSGK--------NLH-INFIPQ 22041160 TFYSNKEIFLWELISNASDALDKIRYES-LTDPS--KLDSGK--------ELK-IDIIPN 20881809 SFYSNKEIFLQELIYNASNALYKIQYES-LIDPS--KLDNS---------ELK-IDIIPN 21239744 TFYSNKEIFLRELISNSSYALDKIRFES-LTDKS--KLDAQP--------ELF-IHIVPD 20878352 NFYSHKEISLGEWISSASDVLNEIPFET-LTYSS--N-KTRL--------KLK-IDIR-D 21289472 SLYRNKEIFLRELISNASDALDKIRLLS-LTD--PSVLDSNR---------NLEVKIKAD 21357739 SLYRNKEIFLRELISNASDAIDKIRLLA-LSN--SKELETNP---------ELHIRIKAD 729425 SLYKNKEIFLRELISNASDALDKIRLIS-LTD--ENALAGNE---------ELTVKIKCD 7294254 SLYKNKEIFLRELISNASDALDKIRLIS-LTD--ENALAGNE---------ELTVKIKCD 16041057 SLYKNKEIFLRELISNASDALDKIRLIS-LTD--ENALAGNE---------ELTVKIKCD 17865698 SLYKNKEIFLRELISNASDALDKIRLIS-LTD--ENALAGNE---------ELTVKIKCD 14327942 SLYKNKEIFLRELISNASDALDKIRLIS-LTD--ENALSGNE---------ELTVKIKCD 14714615 SLYKNKEIFLRELISNASDALDKIRLIS-LTD--ENALAGNE---------ELTVKIKCD 6015101 SLYKNKEIFLRELISNASDALDKIRLIS-LTD--EQALSGNE---------ELTVKIKCD 2267127 SLYKNKEIFLRELISNASDALDKIRLIS-LTD--ENALAGNE---------ELTVKIKCD 63509 SLYKNKEIFLRELISNASDALDKIRLIS-LTD--ENALAGNE---------ELTVKIKCD 2119732 SLYKNKEIFLRELISNASDALDKIRLIS-LTD--ENALAGNE---------ELTVKIKCD 119359 SLYKNKEIFLRELISNASDALDKIRLIS-LTD--ENALAGNE---------ELTVKIKCD 14579649 SLYKNKEIFLRELISNASDALDKIRLIS-LTD--ENALAGNE---------ELTVKIKCD 17542208 SLYRNKEIFLRELISNASDALDKIRLLS-LTD--PEQLRETE---------EMSVKIKAD 10644561 SLYRNKEIFLRELISNASDALXKIRLIS-LTN--STALAATE---------ELSIKI--- 7673568 SLYKNKEIFLRELISNASDALDKVRVLS-LTN--NEMLNESD---------EMSIRIKAN 5442420 SLYSNKDIFLRELISNASDALDKIRFLA-LTD--KEVMGEGDT-------AKLEIQIKLD 544242 SLYSNKDIFLRELISNASDALDKIRFLA-LTD--KEVMGEGDT-------AKLEIQIKLD 18855040 SLYSNKDIFLRELISNASDALDKIRFLA-LTD--KEVLGEGDT-------AKLEIQIKLD 462013 SLYSNKDIFLRELISNASDALDKIRFLA-LTD--KEILGEGDT-------AKLEIQIKLD 15233740 SLYSNKDIFLRELISNASDALDKIRFLA-LTD--KDVLGEGDT-------AKLEIQIKLD 11277137 SLVSKKEIFLRELISNASDALDKIRFLA-LTN--ADLLGEGEQ-------SNLDIHIKID 15228059 SLYSHKEVFLRELVSNASDALDKLRFLS-VTE--PSLLGDGG---------DLEIRIKPD 1906830 SLYSHKEVFLRELVSNASDALDKLRFLS-VTE--PSLLGDGG---------DLEIRIKPD 15628189 SLYSHKEVFLRELVSNASDALDKLRFLS-VTD--SSVLA-GG---------ELEIRIKPD 1076758 SLYSHKEVFLRELVSNASDALDKLRFLS-VTD--SSVLADGG---------ELEIRIKPD 15231505 SLYSNKEVFLRELISNASDALDKLRYLS-VTN--PELSKDAP---------DLDIRIYAD 3273568 SLYSQKDVFLRELLSNSADALEKARFIS-VTD--DSFLGEQQ---------ELEIRVSFN 19880568 SLYTNRAVFLRELISNGSDALDKIRVLY-LTSPKEPLTKDGEA-------PTMDLRISFD 7689258 SLYTNRAVFLRELISNGSDALDKIRVLY-LTSPKEPLTKDGEA-------PTMDLRISFD 1708336 SLYSNKEIFLRELISNASDAADKLR----FKALSNPDLYA--------GDGELRVCISFD 16272078 SLYSNKEIFLRELISNASDAADKLR----FKALSNPALYE--------GDGDLRVRVSFD 15602889 SLYSNKEIFLRELISNASDAADKLR----FKALSVPELYE--------GDGDLKVRIRFD 16759466 SLYSNKEIFLRELISNASDAADKLR----FRALSNPDLYE--------GDGELRVRVSFD 17865481 SLYSNKEIFLRELISNASDAADKLR----FRALSNPDLYE--------GDGELRVRVSFD 16763867 SLYSNKEIFLRELISNASDAADKLR----FRALSNPDLYE--------GDGELRVRVSFD 15800202 SLYSNKEIFLRELISNASDAADKLR----FRALSNPDLYE--------GDGELRVRVSFD 16123284 SLYSNKEIFLRELISNASDAADKLR----FRALSNPELFE--------GDGELRVRLSFD 15641000 SLYSNKEIFLRELISNASDAVDKLR----FQALSHPDLYQ--------GDAELGVKLSFD 5825486 SLYSNKEIFLRELISNASDAANKLS----FQVLSNPALYE--------NDAELG-KL--- 1708338 SLYSNKEIFLRELISNASDASDKLR----FKALSNGDLYE--------GNADLGVKLSFN 15596793 SLYSNKEIFLRELISNASDAADKLR----FEALANPELLE--------GGAELKIRVSFD 23060493 SLYSNKEIFLRELISNASDAVDKLR----FEALAKPELLE--------DGAELKIRVSFD 23102358 SLYSNKEIFLRELISNASDAADKLR----FEALSRPELLE--------DDAELKIRISFD 21243261 SLYSNKEIFLRELVSNAADAADKLR----FEALVKPELLE--------GSGELRIRVDYD 21231830 SLYSNKEIFLRELVSNAADAADKLR----FEALVKPELLE--------GSGELRIRVDFD 22995135 SLYSNKEIFLRELISNAADAADKLR----FEALSAPSLLE--------EDPNLRIRVEFD 22997683 YLYSNKEIFLRELISNAADAADKLR----FEALSAPSLLE--------EDPNLRIRVEFD 15837580 SLYSNKEIFLRELISNAADAADKLR----FEALSAPALLE--------EDPNLRIRVEFD 23026686 SLYSNKEIFLRELVSNASDAADKLR----FEALKQPELLE--------QDSELKITIDFD 22976164 SLYSNKEIFLRELVSNASDATDKLR----FEAIANPALLE--------NDADLAIRIEAD 17545709 SLYSNKEIFLRELVSNASDAVDKLR----FEGIADPSLLE--------GGGELGIRIGFD 22985781 SLYSNKEIFLRELISNASDAADKLR----FEAIENSALYE--------NDPNLRIRVSYD 22955614 SLYSNKEIFLRELISNASDAADKLR----FEGLSDAALYE--------SDPDLKIRIAYD 23001902 ALYSNKEIFLRELISNASDANDKLR----FAGLSDDSLFE--------GDSELTIKLEFD 15617081 SLYSNKEIFLRELISNSSDAIDKLR----FESISSPELYE--------NDSDVKIQISIN 21672733 SLYSNKEIFLRELISNASDAIDKLR----FQSISNPELYE--------NDSDFKIQISIN 23015985 SLYSNKEIFLRELISNASDSCDRLR----YAAITEPDLMA--------GDSEFRIRLIPN 22965455 SLYSDRKIFLRELISNASDACDKLR----YEGLTQPALLE--------GDGAFRIRLSID 15893225 SLYSNKEIFMRELISNASDACDKLR----YLSQSNSELVA--------GDSNFKITVKVD 15604670 SLYSNKEIFMRELISNASDACDKLR----YLSQSNSELIA--------GDSNFKIIVKVD 23053556 SLYSNKDIFLRELISNSSDAIDKVL----FEAHQNAAVIE--------GEPEGKIKLIPD 15613570 SIYSQKEIFLRELISNASDAIDKIY----YRALSDDSITF--------NKDDYFIKVTAN 16081033 SIYTQKEIFLRELISNSSDAIDKIY----YKALTDDALTF--------DKDSYYIKVAAD 18309398 SIYTNREIFLRELISNASDAIDKVY----YKTLGDSSLTF--------NKDDYYIKIKPN 15896558 SIYTNKEIFLRELISNASDAIDKCY----YRSLVDTNITF--------NKDDFYIRISAD 23100613 SIYSQREVFLRELISNASDAIDKIY----YKALTDDSLSF--------DVDNYYIKITPN 19703666 SIYTNKEIFLRELISNANDAIDKLK----FQSLTDTDILK--------DNDKFRIDISVD 15594905 SLYSHKEIFLRELISNASDAIDKLK----FLSLTNEKFKN--------IALEPKIEISFD 15791880 SLYSNKEIFLRELISNASDALDKLN----FLSVSDDKYKS--------LKFEPKIEIKID 15611266 SLYSNKEIFLRELISNASDALDKLN----YLMLTDEKLKG--------LNTTPSIHLSFD 15644838 SLYSNKEIFLRELVSNASDALDKLN----YLMLTDEKLKG--------LNTTPSIHLSFD 15639968 SLYSHKEIFLRELISNASDALDKLK----YEALVDGTYKQ--------LHCEARIDIAFE 22961977 SVYSETDIFLRELISNASDALDKLR----YESIAKPELME--------KGGEPKIRIIPK 15827855 SVYSNKDAFLRELISNASDALDKLR----LEAFRNKDLDPRT-----VDTSDLHIEIEVD 15609436 SVYSNKDAFLRELISNASDALDKLR----IEALRNKDLE--------VDTSDLHIEIDAD 21225782 SVYSNKDVFLRELVSNASDALDKLR----LAALRDDAPD--------ADVSDLHIELEVD 21294891 SLYSDKEVFVRELVSNASDALEKFR----FLVQTSTGAASDEAGEFAEADRSLEIHIGTN 17137688 SLYSDHEVFVRELISNASDALEKFR----YTSLSAGGEN------LAGKDRPLEIRITTD 1082886 SLYSEKEVFIRELISNASDALEKLR----HKLVSDGQALPE-----------MEIHLQTN 21752190 SLYSEKEVFIRELISNASDALEKLR----HKLVSDGQALPE-----------MEIHLQTN 13385998 SLYSEKEVFIRELISNASDALEKLR----HKLVCEGQVLP------------MEIHLQTD 13905144 SLYSEKEVFIRELISNASDALEKLR----HKLVCEGQVLP------------MEIHLQTD 17402847 SLYSHSEVFVRELISNASDALEKRR----YAELKGDVAEGP-----------SEIRITTN 21673658 SLYTHPEIFLRELISNASDALGKAR----FRMLSSDEGLDK--------SGDLKITITVD 23112245 SLYTDREIFLRELISNAADASEKVR----YMQLSGQNVKDQ--------ELPLEIRITPD 22974366 -----------------------------------------------------------N 13471897 SVYSDKDVFLRELISNAADACEKLR----FEAVSRPELLGD--------DPKPRISISAD 16264597 SVYSDKNVFLRELISNAADACEKLR----YEAIVAPELLGS--------DPASRITLTLD 19074029 SVYSSKELFLRELVSNSSDACDKLKALY-FQLREKGCVLDP--------VTSLGIEIIPN 22970048 SLYTDREIFLRELISNASDAINRVQFEMLTNREVRPDLEPQ-------------ITIEVN 17865477 FLYSDHEIFLRELVSNAVDATQKLNTLA-SISEFKGELGDLT------------VHVSLG 17865496 FLYSDHEIFLREIVSNAVDATQKLKTLT-SVGEFKGETGDLR------------VTVSVD 23136628 FLYSDHEIFLRELVSNAVDATQKLKRLA-ALGEYPGELGDTK------------VTVSVN 16332281 SLYTDHEIFLRELISNAVDAISKRKMAA-FASDGSGEVPDPQ------------ITLVVD 23042149 SLYTDHEIFLRELVSNGVDAIAKLKMVA-RTGEYSGDVTNPE------------IEIKID 22298734 WLYSDHEIFLRELVSNAVDAIQKLRMVA-RSGEYSGDVDHPE------------VTITID 6136879 SLYSEHEIFLRELISNAVDAIQKLKMVS-YAGELEGEIGDPQ------------ITLSID 23122748 AVYSDHEIFLRELVSNAVDAISKRRMAS-MAGDCEN-CDEPQ------------VKITID 17451483 -------------------------------DSS--KLDSGK---------GLHINLVPN 22041746 LTSCHRHSRLAETMPNANLILPCLLPES-LTDPS--KLDSGK---------EPHISLIPN 20827505 ----------QELISNASDDLDKIQYDS-LMDPS--KLNSRK---------ELKIDSIPN 20848817 MPEEVHHGEEEELISNTSDTLDKIQYES-LTDPS--KLDRGK---------ELKIDIIPN 20862694 WYLCFCSSEGTYLLGN------KIRYKS-LTNPS--KLDLGK---------NMHINLILN 20855641 --------------------------------PS--KLDSGK---------QLKIDIIPN 20879409 ------------------------------------------------------------ 5817861 GLEAVKKRPGMYI-GSTGER----GLHHLVWEIVDNSIDEAL-------CGYADEITIEI 19705416 GLEAVRKRPGMYI-GTTSER----GLHHLVWEIVDNSVDEAL-------AGYCDKIEVKI 21397975 GLEAVRKRPGMYI-GSTSGK----GLHHLVWEIVDNSIDEAL-------AGYCDEINVSI 15612569 GLEAVRKRPGMYI-GSTSSR----GLHHLVWEIVDNSIDEAM-------AGFCDEIGVVI 16077074 GLEAVRKRPGMYI-GSTNSK----GLHHLVWEIVDNSIDEAL-------AGYCTDINIQI 23097461 GLEAVRKRPGMYI-GSTSEK----GLHHLVWEIVDNSIDEAL-------AGYCDHIQVVV 15982567 GLEAVRKRPGMYI-GSTSGE----GLHHLVWEIVDNSIDEAL-------AGFAKSIQVII 22991526 GLEAVRKRPGMYI-GSTSSE----GLHHLVWEIVDNSIDEVL-------AGFATKIHVII 15674782 GLEAVRMRPGMYI-GSTAKE----GLHHLVWEIVDNSIDEAL-------AGFASHIKVFI 19745824 GLEAVRMRPGMYI-GSTAKE----GLHHLVWEIVDNSIDEAL-------AGFASHIKVFI 21910012 ------MRPGMYI-GSTAKE----GLHHLVWEIVDNSIDEAL-------AGFASHIKVFI 22536796 GLEAVRMRPGMYI-GSTSKE----GLHHLVWEIVDNSIDEAL-------AGFAGHIKVYI 1052804 GLEAVRMRPGMYI-GSTSKE----GLHHLVWEIVDNSIDEAL-------AGFASHIQVFI 15900699 GLEAVRMRPGMYI-GSTSKE----GLHHLVWEIVDNSIDEAL-------AGFASHIQVFI 1490397 GLEAVRMRPGMYI-GSTSKE----GLHHLVWEIVDNSIDEAL-------AGFASHIQVFI 15672887 GLEAVRMRPGMYI-GSTSKE----GLHHLVWEIVDNSIDEAL-------AGFASHIEVFI 16799085 GLEAVRKRPGMYI-GSTSQR----GLHHLVWEIVDNAIDEAL-------AGFCTEIEITI 16802054 GLEAVRKRPGMYI-GSTSQR----GLHHLVWEIVDNAIDEAL-------AGFCTEIEITI 153085 GLEAVRKRPGMYI-GST-QR----ELH-ISVEIVDNSIDEAL-------AGYANKIEVVI 15922995 GLEAVRKRPGMYI-GSTSER----GLHHLVWEIVDNSIDEAL-------AGYANKIEVVI 23024059 GLEAVRKRPGMYI-GTTTAQ----GLHHLVWEIVDNGIDEAL-------AGFASHITVTI 23036988 GLEAVRKRPGMYI-GSTASS----GLHHLVWEIIDNGIDEAL-------AGFAHHVTLTI 23003074 GLEAVRKRPGMYI-GSTSSQ----GLHHLVWEIIDNSIDERL-------AGFATKIEITV 462227 GLEAIRKRPGMYI-GATNAR----GLHHLVWEIVDNSIDEVL-------ANFANKIKIIL 16078870 -----------YI-GSTDAR----GLHHLVYEIVDNSVDEVL-------AGHGDHIIVKI 3914289 GLEAVRKRPGMYI-GSTDAR----GLHHLVYEIVDNSVDEVL-------AGHGDHIIVKI 21401521 GLEAVRKRPGMYI-GSTDSR----GLHHLVYEIVDNSVDEAL-------AGFGDEISVVI 15614703 GLEAVRKRPGMYI-GSTDSR----GLHHLVYEIVDNAVDEAL-------AGYGSNINVTI 23099148 GLDAVRKRPGMYI-GSTDIR----GLHHLVYEIVDNAVDEAL-------AGYGKEIQVTI 15924344 GLEAVRKRPGMYI-GSTDKR----GLHHLVYEIVDNSVDEVL-------NGYGNEIDVTI 1709584 GLEAVRKRPGMYI-GSTDKR----GLHHLVYEIVDNSVDEVL-------NGYGNEIDVTI 15982570 GLEAVRKRPGMYI-GSTDSR----GLHHLVYEIVDNAVDEAL-------SGYGNEINVTI 16800393 GLEAVRKRPAMYI-GSTDVR----GLHHLVYEIVDNSVDETL-------AGFGKKIVVTL 16803326 GLEAVRKRPAMYI-GSTDVR----GLHHLVYEIVDNSVDETL-------AGFGKKIVVTL 15900737 GLDAVRKRPGMYI-GSTDGA----GLHHLVWEIVDNAVDEAL-------SGFGDRIDVTI 15902800 GLDAVRKRPGMYI-GSTDGA----GLHHLVWEIVDNAVDEAL-------SGFGDRIDVTI 15672961 GLDAVRKRPGMYI-GSTDGT----GLHHLVWEIVDNAVDEAL-------SGFGNRISVTI 15186713 ----------MYI-GSTDGT----GLHHLVWEIVDNAVDEAL-------SGFGNRIDVII 22537312 GLDAVRKRPGMYI-GSTDGT----GLHHLVWEIVDNAVDEAL-------SGFGNRIDVII 15674930 GLDAVRKRPGMYI-GSTDAT----GLHHLIWEIVDNAVDEAL-------SGFGDDIKVVI 23023557 GLEAVRKRPGMYI-GSTDGR----GLHHLVYEIVDNAVDEAL-------GGYGNEIRVTI 23037924 GLEAVRVRPGMYI-GSTDTR----GLHHLVWEIVDNAVDEIL-------AGYGDSIKVII 23002511 ----------MYI-GSTDRH----GLNQLVYEIVDNSVDEAM-------AGYGKEINVTI 21708093 GLEAVRKRPGMYI-GSTDNK----GLHHLVWEIVDNAIDEAL-------AGYCTQIDVIL 938029 GLEAVRKRPGMYI-GSTDNK----GLHHLVWEIVDNAIDEAL-------AGYCTQIDVIL 1708093 GLEAVRKRPGMYI-GSTDNK----GLHHLVWEIVDNAIDEAL-------AGYCTQID--L 7387745 GLEAVRKRPGMYI-GSIGFR----GLHHLIWEIVDNSVDEAM-------AGFATNIEVKL 1170146 GLEAVRKRPGMYI-GSIGFK----GLHHLLWEIVDNSVDEAM-------AGFATEIKIKL 15829210 GLEPVRKRPGMYI-GTTGKK----GLHHLIWEIVDNSVDETM-------AGFASQITITL 13507742 GLEAVRKRPGMYI-GSTGEE----GLHHMIWEIIDNSIDEAM-------GGFASTVKLTL 22127614 GLEAVRKRPGMYI-GSTGEE----GLHHMIWEIIDNSIDEAM-------GGFASTVKLTL 2127614 GLEAVRKRPGMYI-GSTGEE----GLHHMIWEIIDNSIDEAM-------GGFASTVKLTL 12044853 GLEAVRKRPGMYI-GSTGEE----GLHHMIWEIVDNSIDEAM-------GGFASFVKLTL 1346241 GLSAVRKRPGMYI-GSTDQK----GLHHMIWEIIDNSVDEMM-------AGYGTTVKLTL 13357637 GLEAVRKRPGMYI-GSTQSE----GLHHMIWEIVDNSIDEAM-------GGFATIVRVIL 4099111 ----------MYI-GSTDIT----GLHHLVWEIVDNALDEAL-------AGFATDIKVTL 21903715 GLDAVRKRPGMYI-GSTDSS----GLHHLIWEIFDNAIDEAL-------SGFANKIIVTL 15828843 GLEAVRKRPGMYI-GSTDIN----GLHHLVWEIFDNAVDEAL-------AGYASIIKVSL 529464 GLEPVRKRPGMYI-GSTDTR----GLHHLVWELFDNAVDEAL-------NGSANKIEVVH 13358029 GLEAVRKRPGMYI-GSTSST----GLHHLIWEIVDNSIDEVM-------NANAKNINVIL 12045055 GLDAVKKRPGMYI-GSTDSK----GLHHMLWEILANSVDEVL-------AGYATNITVTL 13507861 GLDAVKKRPGMYI-GSTDSR----GFHHLLWEILDNCVDEVL-------SGFANTIAVVL 15894905 KLEPVRIRPGMYI-GSTGSK----GLHHCIWEILDNAIDELT-------NGFGDMAKIIL 18311051 KLEPVRVRPGMYI-GSTGSK----GLHHCIWEILDNSIDEIS-------NGYGNKAKVIL 21309845 GLEAVRKKPGMYI-DSVTMK----GAYHLIWEIIDNSIDEAL-------AGY--ATEIIL 18414465 GLDPVRKRPGMYI-GSTGSR----GLHHLVYEILDNAIDEAQ-------AGYASKVDVVL 9955568 GLDPVRKRPGMYI-GSTGSR----GLHHLVYEILDNAIDEAQ-------AGYASKVDVVL 15228245 GLDPVRKRPGMYI-GSTGSR----GLHHLVYEILDNAIDEAQ-------AGFASKIDVVL 6630698 ALDGVRTRPGMYI-GSTGSR----GLHHLVYEILDNAVDEAQ-------AGYATKVDVIL 19909727 ---------------------------HLVYEVVDNSIDEAL-------AGYCTHIEVDI 19909729 ---------------------------HLVYEVVDNSIDEAL-------AGYCTHIEVDI 23128092 GLEAVRKRPGMYI-GTTGPR----GLHHLVYEVVDNSIDEAL-------AGHCTHIEVDI 17232757 GLEAVRKRPGMYI-GSTGPR----GLHHLVYEVVDNSIDEAL-------AGYCTHIE--I 23043187 GLEAVRKRPGMYI-GTTGPR----GLHHLVYEVVDNSIDEAL-------AGYCTHIEVDL 19909553 ------------------------GLHHLVYEVVDNSVDEAL-------AGYCKAIDISI 16330312 GLEPVRKRPGMYI-GSTGPK----GLHHLVYEVVDNAIDEAL-------AGYCTHIEIDI 19909557 --------------------------------VVDNAVDKAL-------AGYCNTIDVRL 22298189 GLEPVRTRPGMYI-GSTGPK----GLHHLVYEVVDNSVDEAL-------AGYCSTILVQI 23130837 GLEPVRKRPGMYI-GSTGPR----GLHHLVFEVVDNSVDEAL-------AGHCDEILVVL 23132789 GLEPVRKRPGMYI-GTTGPR----GLHHLVYEVVDNSVDEAL-------AGHCDRILVTL 23123435 GLEPVRKRPGMYI-GSTGPR----GLHHLVYEVVDNSVDEAL-------AGHCDHIEIVL 13812265 GLEPVRRRPGVFI-GSTGLK----GFHHLVYEIVDNSVDESM-------AGFCEKVDVII 6644316 ------------------------------------------------------------ 15530000 ------------------------------------------------------------ 6644317 ------------------------------------------------------------ 6644324 ------------------------------------------------------------ 6644322 ------------------------------------------------------------ 15530563 ------------------------------------------------------------ 6644326 ------------------------------------------------------------ 6644323 ------------------------------------------------------------ 3320890 ------------------------------------------------------------ 6644148 ------------------------------------------------------------ AAN03628.1 ------------------------------------------------------------ 15551673 ------------------------------------------------------------ 2196850 ------------------------------------------------------------ 2196852 ------------------------------------------------------------ 2196854 ------------------------------------------------------------ 15551715 ------------------------------------------------------------ 15551725 ------------------------------------------------------------ 22091020 ------------------------------------------------------------ 15551717 ------------------------------------------------------------ 7407142 ------------------------------------------------------------ 15551723 ------------------------------------------------------------ 22091034 ------------------------------------------------------------ 22091026 ------------------------------------------------------------ 22091032 ------------------------------------------------------------ 22090910 ------------------------------------------------------------ 22090932 ------------------------------------------------------------ 15551675 ------------------------------------------------------------ 22091036 ------------------------------------------------------------ 16762490 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNAIDEAL-------AGHCKDIVVTI 1546916 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNAIDEAL-------AGHCKDIVVTI 22090642 ------------------------------------------------------------ 22090904 ------------------------------------------------------------ 15804293 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNAIDEAL-------AGHCKEIIVTI 7546302 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNAIDEAL-------AGHCKEIIVTI 3212436 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNAIDEAL-------AGHCKEIIVTI 15551701 ------------------------------------------------------------ 15551697 ------------------------------------------------------------ 15551685 ------------------------------------------------------------ 15551677 ------------------------------------------------------------ 19909647 ------------------------------------------------------------ 15551683 ------------------------------------------------------------ 15551693 ------------------------------------------------------------ 15551691 ------------------------------------------------------------ 15551681 ------------------------------------------------------------ 15551679 ------------------------------------------------------------ 15551695 ------------------------------------------------------------ 22091042 ------------------------------------------------------------ 22127978 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNAIDEAL-------AGHCKEILVTI 7107361 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNAIDEAL-------AGHCKEILVTI 15551719 ------------------------------------------------------------ 15551713 ------------------------------------------------------------ 15551711 ------------------------------------------------------------ 15551709 ------------------------------------------------------------ 15551705 ------------------------------------------------------------ 15551721 ------------------------------------------------------------ 2267054 ------------------------------------------------------------ 15603341 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNSIDEAL-------AGYAKDITVTI 15551707 ------------------------------------------------------------ 16272510 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNAIDEAL-------AGHCSDIIVTI 4894891 ------------------------------------------------------------ 4894893 ------------------------------------------------------------ 6018677 ------------------------------------------------------------ 6018679 ------------------------------------------------------------ 4894892 ------------------------------------------------------------ 6456476 ------------------------------------------------------------ 4894894 ------------------------------------------------------------ 2853305 ------------------------------------------------------------ 6016182 ------------------------------------------------------------ 19909651 ---------------TDDGT----GLHHMVFEVVDNSIDEAL-------AGHCKDIVVTI 2853307 ------------------------------------------------------------ 2853310 ------------------------------------------------------------ 19909659 ------------------GT----GLHHMVFEVVDNSIDEAL-------AGHCNDIIVTI 15640047 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNSIDEAL-------AGYCKDIVVTI 19909653 -----------------DGT----GLHHMVFEVVDNSIDEAL-------AGHCKDIIVTI 19909655 -------------------T----GLHHMVFEVVDNSIDEAL-------AGYCKDIIVTI 19909621 ------------------------------------------------------------ 19909623 ------------------------------------------------------------ 19909617 ------------------------------------------------------------ 9971293 ------------------------------------------------------------ 2267058 ------------------------------------------------------------ 2267076 ------------------------------------------------------------ 2267066 ------------------------------------------------------------ 2267072 ------------------------------------------------------------ 2267062 ------------------------------------------------------------ 2267068 ------------------------------------------------------------ 2267074 ------------------------------------------------------------ 2267078 ------------------------------------------------------------ 9802387 ------------------------------------------------------------ 2267060 ------------------------------------------------------------ 4835907 ------------------------------------------------------------ 2267080 ------------------------------------------------------------ 2267070 ------------------------------------------------------------ 2267064 ------------------------------------------------------------ 2353016 ------------------------------------------------------------ 2905610 ------------------------------------------------------------ 2353020 ------------------------------------------------------------ 2353018 ------------------------------------------------------------ 2196838 ------------------------------------------------------------ 2353024 ------------------------------------------------------------ 2905604 ------------------------------------------------------------ 2905606 ------------------------------------------------------------ 2196790 ------------------------------------------------------------ 2196812 ------------------------------------------------------------ 2196808 ------------------------------------------------------------ 2196810 ------------------------------------------------------------ 2905602 ------------------------------------------------------------ 2905608 ------------------------------------------------------------ 4894896 ------------------------------------------------------------ 2196846 ------------------------------------------------------------ 18147145 ------------------------------------------------------------ 18147173 ------------------------------------------------------------ 18147183 ------------------------------------------------------------ 18147185 ------------------------------------------------------------ 18147179 ------------------------------------------------------------ 18147177 ------------------------------------------------------------ 18147151 ------------------------------------------------------------ 18147169 ------------IGDTDDGT----GLHHMVFEVVDNSIDEAL-------AGFCSEIKVVI 18147181 ---------------TDDGT----GLHHMVFEVVDNSIDEAL-------AGFCSEIKVVI 18147143 ------------------------------------------------------------ 18147175 ------------------------------------------------------------ 18147161 ------------------------------------------------------------ 18147163 ------------------------------------------------------------ 18147157 ------------------------------------------------------------ 18147171 ------------------------------------------------------------ 18147155 --------------DTDDGT----GLHHMVFEVVDNSIDEAL-------AGFCSEIRVVI 18147153 ------------------------------------------------------------ 18147159 ------------------------------------------------------------ 18147167 ------------------------------------------------------------ 18147165 ------------------------------------------------------------ 18147141 ------------------------------------------------------------ 19909605 ------------------------------------------------------------ 19909599 -----------------DGT----GLHHMVFELVDNSIDEAL-------AGYCSEIRVII 19909601 -----------------DGT----GLHHMVFELVDNSIDEAL-------AGHCSEIRVVI 18147147 ------------------------------------------------------------ 19909595 ------------------------GLHHMVFELVDNSIDEAL-------AGHCSEIRVVI 19909597 -------------------------LHHMVFELVDNSIDEAL-------AGHCTEIRVII 13359140 ------------------------------------------------------------ 18147149 ---------------SDDGS----GLHHMVFELVDNGIDEAL-------AGHCSEIAVII 13359144 ------------------------------------------------------------ 19909619 ------------------------------------------------------------ 23027048 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEIVDNSIDEAL-------AGHCNEIKVVI 22087113 ------------------------------------------------------------ 9971301 ------------------------------------------------------------ 9971299 ------------------------------------------------------------ 9971295 ------------------------------------------------------------ 23104602 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNSIDEAL-------AGYCNEISITI 11078745 ------------------------------------------------------------ 11078719 ------------------------------------------------------------ 11078727 ------------------------------------------------------------ 11078897 ------------------------------------------------------------ 11078717 ------------------------------------------------------------ 11078715 ------------------------------------------------------------ 11078765 ------------------------------------------------------------ 11078723 ------------------------------------------------------------ 11078725 ------------------------------------------------------------ 11078751 ------------------------------------------------------------ 11078835 ------------------------------------------------------------ 15595202 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNSIDEAL-------AGYCSEISITI 6116692 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNSIDEAL-------AGYCSEISITI 23057577 GLDAVRKRPGMYIGDTDDGS----GLHHMVFEVVDNSIDEAL-------AGHCDDISIII 19909707 ------------------GS----GLHHMVFEVVDNSIDEAL-------AGHCDDISIII 19909645 ------------------------------------------------------------ 121893 GLDAVRKRPGMYIGDTDDGS----GLHHMVFEVVDNSIDEAL-------AGHCDDITVII 16121893 GLDAVRKRPGMYIGDTDDGS----GLHHMVFEVVDNSIDEAL-------AGHCDDITVII 19909609 ------------------------------------------------------------ 19909615 ------------------------------------------------------------ 2267056 ------------------------------------------------------------ 19909607 ------------------------------------------------------------ 9971297 ------------------------------------------------------------ 4996776 ---------------TDDGT----GLHHMVFEVVDNAIDEAL-------AGYCTEVTVTL BAA78433.1 -----------------DGT----GLHHMVFEVVDNAIDEAL-------AGYCTEVTVTL 19909611 ------------------------------------------------------------ 19909531 ------------------------------------------------------------ 19909671 -----------------------------VFEVADNSIDEAL-------AGYCTEVAIVI 13487309 ------------------------------------------------------------ 13487323 ------------------------------------------------------------ 19909723 -----------------DGP----GLHHMVFEVLDNAIDEAL-------AGHCDTIRITI 3550425 GLDAVRKRPGMYIGDTSDGS----GLHHMVFEVLDNAIDEAL-------AGHCDDIKVII 4996790 ----------------SDGT----GLHHMVFEVVDNAIDEAL-------AGHCDDIVVTI BAA78440.1 ------------------GT----GLHHMVFEVVDNAIDEAL-------AGHCDDIVVTI 4996818 -----------------DGT----GLHHMVFEVVDNAIDEAL-------AGHCDDIVVTI BAA78454.1 ------------------GT----GLHHMVFEVVDNAIDEAL-------AGHCDDIVVTI 4996816 -----------------DGT----GLHHMVFEVVDNAIDEAL-------AGYCDDIVVMI BAA78453.1 ------------------GT----GLHHMVFEVVDNAIDEAL-------AGYCDDIVVMI 4996832 --------------RTSDGT----GLHHMVFEVVDNAIDEAL-------AGYCDDIVVTI BAA78461.1 ------------------GT----GLHHMVFEVVDNAIDEAL-------AGYCDDIVVTI 11270924 ------------------------------------------------------------ 22954054 GLDAVRKRPGMYIGDTSDGT----GLHHMVFEVVDNAIDEAL-------AGYCDDISVII 11270928 ------------------------------------------------------------ 11270934 ------------------------------------------------------------ 11270926 ------------------------------------------------------------ 19909685 ------------------------GLHHLVFEVLDNSIDEAL-------AGYCNDIHVTI 22984295 GLEAVRKRPGMYIGDTSDGT----GLHHLVFEVLDNSIDEAL-------AGHCNDIQVII 19909711 ------------------GT----GLHHLVFEVLDNSIDEAL-------AGYCTEIQVTI 19909715 ------------------GT----GLHHLVFEVLDNSIDEAL-------AGYCTEIQVTI 19909713 ------------------GT----GLHHLVFEVLDNSIDEAL-------AGYCTEIQVTI 19909709 ------------------GT----GLHHLVFEVLDNSIDEAL-------AGYCTEIQVTI 17548157 GLEAVRKRPGMYIGDTSDGT----GLHHLVFEVLDNSIDEAL-------AGHCTEIHVTI 19909661 ------------------------------------------------------------ 19909721 ------------------------------------------------------------ 1944019 ------------------------------------------------------------ 4996804 --------------RTSDGT----GLHHLVFEVVDNSIDEAL-------AGHCDDIVVTI BAA78447.1 ------------------GT----GLHHLVFEVVDNSIDEAL-------AGHCDDIVVTI 4996796 --------------DTSDGT----GLHHLVFEVVDNSIDEAL-------AGHCDDIVVTI BAA78443.1 ------------------GT----GLHHLVFEVVDNSIDEAL-------AGHCDDIVVTI 4996788 --------------DTSDGT----GLHHLVFEVVDNSIDEAL-------AGHCDDIVVTI BAA78439.1 ------------------GT----GLHHLVFEVVDNSIDEAL-------AGHCDDIVVTI 4996798 ----------------SDGT----GLHHLVFEVVDNSIDEAL-------AGHCDDIVVTI BAA78444.1 ------------------GT----GLHHLVFEVVDNSIDEAL-------AGHCDDIVVTI 4996834 ----------------SDGT----GLHHLVFEVVDNSIDEAL-------AGHCDDIVVTI BAA78432.1 ------------------------GLHHLVFEVVDNSIDEAL-------AGHCDDIVVTI BAA78462.1 ------------------GT----GLHHLVFEVVDNSIDEAL-------AGHCDDIVVTI 19909657 ------------------------------------------------------------ 19909717 -------------------------------------------------------IVVTI 19909683 ------------------------GLHHLVFEVVDNSIDEAL-------AGHCDDIVVTI 4996784 ----------------SDGT----GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI BAA78437.1 ------------------------GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI 4996780 --------------DTSDGT----GLHHLVFEVVDNSIDEAL-------AGYCDDIAVTI BAA78435.1 ------------------------GLHHLVFEVVDNSIDEAL-------AGYCDDIAVTI 4996786 --------------DTSDGT----GLHHLVFEVVDNSIDEAL-------AGYCDDIAVTI BAA78438.1 ------------------------GLHHLVFEVVDNSIDEAL-------AGYCDDIAVTI 4996800 ------------------------GLHHLVFEVVDNSIDEAL-------AGYCDDIAVTI BAA78445.1 -------------------------LHHLVFEVVDNSIDEAL-------AGYCDDIAVTI BAA78436.1 ------------------------------------------------------------ 4996826 ------------------GT----GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI BAA78458.1 ------------------------GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI 4996828 ----------------SDGT----GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI BAA78450.1 ------------------------GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI BAA78448.1 -------------------------LHHLVFEVVDNSIDEAL-------AGYCDDILVTI 1944015 ------------------------------------------------------------ 1944017 ------------------------------------------------------------ 19909703 -------------------------LHHLVFEVVDNSIDEAL-------AGYCDDILVTI 12060257 --------------DTSDGT----GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI 4996792 ----------------CDGT----GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI BAA78441.1 ------------------------GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI 4996808 ----------------SDGT----GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI BAA78442.1 -------------------------LHHLVFEVVDNSIDEAL-------AGYCDDILVTI 4996820 ------------------GT----GLHHLGFEVVDNSIDEAL-------AGYCDDILVTI BAA78455.1 ------------------------GLHHLGFEVVDNSIDEAL-------AGYCDDILVTI 4996812 ------------------GT----GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI BAB87066.1 ---------------------------------------------------------VTI BAA78451.1 ------------------------GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI 4996824 --------------DTSDGT----GLHHLVFEVVDNSIDEAL-------AGYCDDILVTI 1944013 ------------------------------------------------------------ 16272041 GLEAVRKRPGMYIGDTQDGS----GLHHMVFEVLDNAIDEAL-------AGHCDKITVTI 121891 GLEAVPKRPGMYIGDTQDGS----GLHHMVFEVLDNAIDEAL-------AGHCDKITVTI 482597 GLEAVRKRPGMYIGDTQDGS----GLHHMVFEVLDNAIDEAL-------AGHCDKITVTI 21218915 GLEAVPKRPGMYIGDTQDGS----GLHHMVFEVLDNAIDEAL-------AGHCDKITVTI 15676138 GLEAVRKRPGMYIGDTQDGS----GLHHMVFEVLDNAIDEAL-------AGHCDKITVTI 21672304 GLDAVRKRPGMYIGDTDDGS----GLHHMVFEIVDNSIDEAL-------AGFCKEIKVVI 551761 GLDAVRKRPGMYIGDTDDGS----GLHHMVFEIVDNSIDEAL-------AGFCKEIKVVI 15616640 GLDAVRKRPGMYIGDTDDGS----GLHHMVFEIVDNSIDEAL-------SGYCKEIIVTI 121892 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNAIDEAL-------AGYCDEIIVTI 16121892 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNAIDEAL-------AGYCDEIIVTI 23000011 GLDAVRKRPGMYIGDTDDGT----GLHHMVFEVVDNAIDEAL-------AGHCDRVEVIL 21240778 GLEAVRKRPGMYIGDVHDGT----GLHHMVFEVVDNSVDEAL-------AGHADDIVVKI 21229482 GLEAVRKRPGMYIGDVHDGT----GLHHMVFEVVDNSVDEAL-------AGHADDIVVKI 22993815 GLDAVRKRPGMYIGDVHDGT----GLHHMVFEVVDNSVDEAL-------AGHADSILVKI 22996622 GLDAVRKRPGMYIGDVHDGT----GLHHMVFEVVDNSVDEAL-------AGHADSILVKI 15836610 GLDAVRKRPGMYIGDVHDGT----GLHHMVFEVVDNSVDEAL-------AGHADSILVKI 18916405 -----------------DGS----GLHHMVYEVVDNAIDEAL-------AGHADIVTVTL 15963765 GLDAVRKRPGMYIGDTDDGS----GLHHMVYEVVDNAIDEAL-------AGHADIVTVTL 15887371 GLDAVRKRPGMYIGDTDDGS----GLHHMVYEVVDNAIDEAL-------AGHADLVTVTL 17988106 GLDAVRKRPGMYIGDTDDGS----GLHHMVYEVVDNAIDEAL-------AGHATLVTVTL 13474326 GLDAVRKRPGMYIGDTDDGS----GLHHMVYEVVDNAIDEAL-------AGHADLVTVTL 18916417 ---------------TDDGS----GLHHMVYEVVDNAIDEAL-------AGHASRVLVTL 18916420 ---------------TDDGS----GLHHMVYEVVDNAIDEAL-------AGHASRVLVTL 19979595 -----------------DGS----GLHHMVYEVVDNAIDEAL-------AGHATRVDVIL 19979609 -----------------DGS----GLHHMVYEVVDNAIDEAL-------AGHATRVDVVL 18916429 ---------------TDDGS----GLHHMVYEVVDNAIDEAL-------AGHATRVDVVL 19979613 ---------------TDDGS----GLHHMVYEVVDNAIDEAL-------AGHASRVDVIL 18916423 ---------------TDDGS----GLHHMVYEVVDNAIDEAL-------AGHATRVDVVL 18916432 ---------------TDDGS----GLHHMVYEVVDNAIDEAL-------AGHATRVEVIL 18916435 ---------------TDDGS----GLHHMVYEVVDNAIDEAL-------AGHATRVEVIL 18916441 ---------------TDDGS----GLHHMVYEVVDNAIDEAL-------AGHATRVEVIL 19979597 ---------------TDDGS----GLHHMVYEVVDNAIDEAL-------AGHATRVEVIL 22962001 GLDAVRKRPGMYIGDTDDGS----GLHHMVYEVVDNAIDEAL-------AGHASRVEVIL 18916411 -----------------DGS----GLHHMVYEVVDNAIDEAL-------AGYATRVEVIL 19909743 -------------------S----GLHHMVYEVVDNAIDEAL-------AGHADHVTVTL BAB87067.1 ------------------------GLHHMVYEVVDNAIDEAL-------AGHADHVTVTL BAB87068.1 -----------------DGS----GLHHMVYEVVDNSIDEAL-------AGHADYVTVTL BAB87069.1 ------------------------GLHHMVYEVVDNSIDEAL-------AGHADYVTVTL 19909745 ----------------DDGS----GLHHMVYEVVDNSIDEAL-------AGHADYVTVTL 22965523 GLEAVRKRPGMYIGDTDDGS----GLHHMVYEVVDNAIDEAL-------AGYCDHSEVIL 19909763 -----------------DGS----GLHHMVYEVVDNAIDEAL-------GGYADYVSVTL 19909543 -----------------DGS----GLHHMVYEVVDNAIDEAL-------AGHADLVEVIL 19909545 -----------------DGS----GLHHMVYEVVDNAIDEAL-------AGHADLVEVIL 19909735 ---------------TDDGS----GLHHMVYEVVDNAIDEAL-------AGHADLVQVIL BAB87063.1 -----------------DGS----GLHHMVYEVVDNAIDEAL-------AGHADLVQVIL 19909737 ---------------TDDGS----GLHHMVYEVVDNAIDEAL-------AGHADLVQVIL BAB87064.1 -----------------DGS----GLHHMVYEVVDNAIDEAL-------AGHADLVQVIL 19909539 -----------------DGS----GLHHMVYEVVDNAIDEAL-------AGWATRVEVIL 1049326 GLDAVRKRPGMYIGDTDDGS----GLHHMVYEVVDNAIDEAL-------AGHATKVQVIL 16124415 GLDAVRKRPGMYIGDTDDGS----GLHHMVYEVVDNAIDEAL-------AGHATKVQVIL 19909537 -----------------DGS----GLHHMVYEVVDNAIDEAL-------AGHATKVQVIL 15892807 GLEAVRKRPGMYIGDVGDGS----GLHHMIYEVVDNAIDESL-------AGYCDLVRVTL 15604433 GLEAVRKRPGMYIGDVGDGS----GLHHMIYEVVDNSIDEAL-------AGYCDLVQVTL 19909663 --------------DTDDGS----GLHHMVFEVSDNAIDEAL-------AGHCDLVLIEL 19909665 --------------DTDDGS----GLHHMVFEVSDNAIDEAL-------AGHCDLVLIEL 19909667 ---------------TDDGS----GLHHMVFEVSDNAIDEAL-------AGHCDLVLIEL BAB87029.1 -----------------DGS----GLHHMVFEVSDNAIDEAL-------AGHCDLVLIEL 19909719 --------------------------HHMVFEVSDNAIDEAL-------AGHCDLVLIEL BAB87055.1 ---------------------------HMVFEVSDNAIDEAL-------AGHCDLVLIEL 23110554 GLDAVRKRPGMYIGDTDDGS----GLHHMVFEVSDNAIDEAL-------AGHCDLVLIEL 19909581 -----------------------------VFEVSDNAIDEAL-------AGHCDKIIIQL 6580765 GLDAVRKRPGMYIGDTDDGS----GLHHMVFEVSDNAIDEAL-------AGYCDLVKIAI 19909695 -------------------------LHHMVYEVVDNGIDEAL-------AGHADFVRVKI 19909739 ---------------------------HMVYEVVDNGIDEVL-------AGHADFVQVKI 18157438 -----------------DGS----GLHHMVYEVVDNGIDEAL-------AGHANYVHVKI 18157436 -----------------DGS----GLHHMVYEVVDNGIDEAL-------AGHATAVTVKI 22956830 GLEAVRKRPGMYIGDTDDGS----GLHHMVYEVVDNGIDEAL-------AGHATAVTVKI 19909633 ------------------------------------------------------------ 18157440 ---------------TDDGS----GLHHMVYEVVDNGIDEAL-------AGHATDVAVII 23016662 GLEAVRKRPGMYIGDTDDGS----GLHRMIYEAVDNAVDEIM-------NGFGDRCDVVL 15643596 GLEPVRMRPGMYIG-STGKR----GLHHLVYEVVDNSVDEAL-------AGYCDWIRVTL 19909675 -------------------------------EVVDNSVDEAL-------AGYCDWIRVTL 19909649 ------------------------GLHHLVYEVVDNSVDESL-------AGYCDWIKVTL 13878524 DLEAVRKRPGMYIG-GVGVR----GLHHLLWEVVDNAVDEAL-------AGYCDTIKVSL 15606321 GLEHVRLRPAMYIG-DIGER----GLHHLIWEILDNAVDEAV-------AGYARNISVTI 19909541 -----------------HSR----GLHHLVYEIVDNSIDETL-------AGFNDYIHVAM 21675071 GIEHVRKRPAMYIG-DIHSR----GLHHLVYEIVDNAIDETL-------AGYNDYIHVAM 21465844 GLEGVRHRPAMYIG-GTGVE----GYHHLFKEILDNAVDEAL-------AGYATEILVRL 15594781 GLEAVRKRPGMYIGSVSIN-----GLHHLVYEVVDNSIDEAL-------AGFCDRIDVII 454038 GLEAVRKRPGMYIGSVSIN-----GLHHLVYEVVDNSIDEAL-------AAFCDRIDVII 6647532 GLEAVRKRPGMYIGSVSIN-----GLHHLVYEVVDNSIDEAL-------AGFCDKIEVVI 4033400 GLEAVRKRPGMYIGSTGPD-----GLHHLVYEVVDNCIDEAM-------AGFCDKILVVL 15639990 GLEAVRKRPGMYIGSTGPN-----GLHHLVYEVVDNCIDEAM-------AGYCDRITVVL 20090442 GLEAVRKRPSMYIGSTDSR-----GLHHLVYEVVDNSIDEAL-------AGFCTRVDVTI 21228521 GLEAVRKRPSMYIGSTDGR-----GLHHLVYEVVDNSIDEAL-------AGFCSEIDVTI 23050010 GLEAVRKRPSMYIGSTDSR-----GLHHLVYEVVDNSIDEAL-------AGFCTIINVTI 10644698 GLDPVRKRPGMYIGSTGAQ-----GLHHLVYEVVDNSIDEAM-------AGYCKNITVTI 11270953 GLEAVRKRPGMYIGTTGTR-----GLHHLVYEIVDNSIDEAL-------AGYCSHIKVFI 18308988 GLEAVRKRPGMYIGSTSSR-----GLHHLVYEIVDNSIDEAL-------AGYCKNIKVYI 23020027 GLEAVRKRPGMYIGSTSSR-----GLHHLVYEIMDNSIDEAL-------AGFCNEIKVII 23112429 ----------MYIGSTSLR-----GLHHLVYEIVDNSIDEAL-------AGYCDTIEVTI 20806552 GLEAVRKRPGMYIGSTGSR-----GLHHLVYEVVDNSIDEAL-------AGYCKNIVVTI 23054293 GLEAVRKRPAMYIGSTASQ-----GLHHLVYEIVDNSIDEAL-------AGYCNEVNVTI 19909691 ----------------DAR-----GLHHLVYEVVDNSIDEAL-------AGYCDRIDVTL 15790024 ----------MYIGSTDAR-----GLHHLVYEVVDNSIDEAL-------AGYCDRIDVTL 19909603 -------------------------LHHLVYEVVDNSIDEAL-------AGYCDRIDVTL 121889 GLEAVRKRPAMYIGSTDSR-----GLHHLVYEVVDNSIDEAL-------AGHCDAIEVAL 21218890 GLEAVRKRPAMYIGSTDSR-----GLHHLVYEVVDNSIDEAL-------AGHCDAIEVAL 19909689 ---------------TDGR-----GLHHLVYEVVDNSIDEAL-------AGYCDEITVTI 15604910 GLQAVRERPGMYIGDTGVT-----GLHHLVYEVVDNSIDEAM-------AGFCTEVVVRI 3510605 GLQAVRERPGMYIGDTGVT-----GLHHLVYEVVDNSIDEAM-------AGFCTEVVVRI 15618195 GLQAVRERPGMYIGDTGIT-----GLHHLVYEVVDNSIDEAM-------AGYCSRIDVRI 15791402 GLEAVRKRPGMYIGDTNIG-----GLHHMIYEVVDNSIDEAM-------AGHCDTIDVEI 3695371 ---------------TNIG-----GLHHMIYEVVDNSIDEAM-------AGHCDTIDVEI 15611520 GLEGVRKRPGMYIGDTNVG-----GLHHMVYEVVDNAVDESM-------AGFCDTINITL 15645128 GLEGVRKRPGMYIGDTNVG-----GLHHMVYEVVDNAVDESM-------AGFCDTINITL 16082085 GLKAVRKVPGMYIGSTDTR-----GLHHLVYEVVDNSVDESV-------AGYCSRIYVVM 13541372 GLKAVRKVPGMYIGSTDTR-----GLHHLVYEVVDNSVDESV-------AGFCSNIYVKI 22405936 GLKAVRKVPGMYIGSTGPD-----GLHHMVYEVVDNCIDEAM-------AGFGSDINIYK 18916466 GLEAVRKRPGMYVGSTGER-----GLHHLIWEVVDNSVDEAM-------AGYATQVDV-- 7437456 GLEAVRKRPGMYVGSTGER-----GLHHLIWEVVDNSVDEAM-------AGYATQVDVRL 13431552 GLEAVRKRPGMYIGSTGER-----GLHHLIWEVVDNSVDEAM-------AGYADRVDVRI 1107468 GLEAVRKRPGMYIGSTGER-----GLHHLIWEVVDNAVDEAM-------AGYATTVNVVL 15835080 GLEAVRKRPGMYIGSTGER-----GLHHLIWEVVDNAVDEAM-------AGFATRVDVKI 1226021 GLEAVRKRPGMYIGSTGER-----GLHHLIWEVVDNAVDEAM-------AGFATRVDVKI BAA78449.1 -------------------------LHHLIWEVVDNAVDEAM-------AGFATRVDVKI 7437446 GLEAVRKRPGMYIGSTGER-----GLHHLIWEVVDNAVDEAM-------AGFATRVDVKI 19551255 GLEAVRKRPGMYIGSTGPR-----GLHHLIWEVVDNSVDEAM-------AGHATKVEVTL 21322770 GLEAVRKRPGMYIGSTGPR-----GLHHLIWEVVDNSVDEAM-------AGHATKVEVTL 6729221 -------------GSTGER-----GLHHLVQEVVDNAVDEAL-------AGYCDIIDVVL 23016964 GLEAVRKRPGMYIGSTGER-----GLHHLVQEVVDNSVDEAL-------AGYATAIEVTL 1708090 GLDAVRKRPGMYIGSTGER-----GLHHLVTEVVDNSVDEAL-------AGHADTIDVTI 7437457 GLDAVRKRPGMYIGSTGER-----GLHHLVQEVVDNSVDEAL-------AGHADTIDVTI 322319 GLDAVRKRPGMYIGSTGER-----GLHHLVQELVDNSVDEAL-------AGVADRIDVTV 22971553 GMEAVRKRPGMYIGPTDIN-----GLHTMVREVVDNSVDEVM-------AGRATSVSVTI 4033395 GREAVRKRPGMYIGDTMAY-----GLHKLVYEVVDNAVDESL-------AGHCTDIEVVI 6006289 GLEAVRKRPAMYI-GDISVK----GLHHLVYEIVDNSIDEAL-------AGYCDHIEVTI 23135434 GLEAVRKRPAMYI-GDIGIK----GLHHLVWEVVDNSIDEAL-------AGHCTDITVEI 10039315 ------------------------------------------------------------ 13358822 ------------------------------------------------------------ 6939900 -------------------------LHHLVYEVVDNSIDEAL-------AGYCTEVLVEI 13517055 ------------------------------------------------------------ 9971355 ------------------------------------------------------------ 13517033 ------------------------------------------------------------ 13517035 ------------------------------------------------------------ 13517065 ------------------------------------------------------------ 21224166 GLEAVRKRPGMYIG-STDSR----GLMHCLWEIIDNSVDEAL-------GGYCDHIEVIL 23017713 GLEAVRKRPGMYIG-STDSR----GLTHCMWEIIDNSVDEAL-------AGYCTRIEVVL 15805931 GMDAVRKRPGMYVQGGTGID----GYHQLLTEIIDNGIDEGL-------AGFAGEIQIVL 19568163 DLEPVQLRPGMYT----DTT----RPNHLAQEVIDNSVDEAL-------AGFATKIEVIL 16273428 DLEPVQIRPGMYT----DTT----RPNHLAQEVIDNSVDEAL-------AGFATKIEVIL 15602235 DLEPVQLRPGMYT----DTT----RPNHLGQEVIDNSVDEAL-------AGYANKIEVVL 11270949 GLDPVRKRPGMYT----DTT----RPNHLAQEVIDNSVDEAL-------AGHAKSVQVIL 15600160 GLDPVRKRPGMYT----DTT----RPNHLAQEVIDNSVDEAL-------AGHAKSVQVIL 23103883 GLDPVRKRPGMYT----DTT----RPNHLAQEVIDNSVDEAL-------AGHAKSVQVIL 23060755 GLDPVRKRPGMYT----DTS----RPNHLAQEVIDNSVDEAL-------AGHAKSIQVIL 19717679 GLEPVRRRPGMYT----DTT----RPNHLGQEVIDNSVDEAL-------AGHAKRVDVIL 16130926 GLEPVRRRPGMYT----DTT----RPNHLGQEVIDNSVDEAL-------AGHAKRVDVIL 15803577 GLEPVRRRPGMYT----DTT----RPNHLGQEVIDNSVDEAL-------AGHAKRVDVIL 19909673 GLEPVRRRPGMYT----DTT----RPNHLGQEVIDNSVDEAL-------AGHAKRVDVIL 16761956 GLEPVRRRPGMYT----DTT----RPNHLGQEVIDNSVDEAL-------AGHAKRVDVIL 3421248 GLEPVRRRPGMYT----DTT----RPNHLGQEVIDNSVDEAL-------AGHAKRVDVIL 421248 GLEPVRRRPGMYT----DTT----RPNHLGQEVIDNSVDEAL-------AGHAKRVDVIL 16120993 GLEPVRRRPGMYT----DTS----RPNHLGQEVIDNSVDEAL-------AGHARRIDVIL 15642428 GLEPVRRRPGMYT----DTT----RPNHLGQEVIDNSVDEAL-------AGYASKIQVIL 23029359 GLDPVKKRPGMYT----DTV----RPNHLAQEIIDNSVDEAL-------AGHAKKIEVIL 21242463 GLDPVKRRPGMYT----DTA----RPNHLAQEVIDNSVDEAL-------AGHAKQVEVTL 21231148 GLDPVKRRPGMYT----DTA----RPNHLAQEVIDNSVDEAL-------AGHAKQVEVTL 15837887 GLDPVKRRPGMYT----DTT----RPNHLAQEVIDNSVDEAL-------AGYANRIEVTL 9971917 GLDPVKKRPGMYT----DTS----NPNHLIQEVLDNSVDEAL-------SGYCSNIKVSV AAG10479.1 GLDPVKKRPGMYT----DTS----NPNHLIQEVLDNSVDEAL-------SGYCSNIKVSV 22977071 GLEPVKQRPGMYT----RTD----NPLHVVQEVIDNASDEAL-------GGYGTEILVTL 17545695 GLEPVKQRPGMYT----RTD----NPLHIVQEVIDNAADEAL-------GGYGKWIQVTL 22987032 GLEPVKQRPGMYT----RTE----NPLHIIQEVIDNASDEAL-------GGHGRQITVTL 15677530 GLEPVKERPGMYT----RTD----SPTHICQEVIDNASDEAL-------GGFATAIDVQI 15794824 GLEPVKERPGMYT----RTD----SPTHICQEVIDNAADEAL-------GGFATAIDVQI 15888935 GLEPVRMRPGMYIGG-TDEK----ALHHLFAEVIDNSMDEAV-------AGHANFIEVHL 15965186 GLEPVRRRPGMYIGG-TDEK----ALHHLFAEVIDNSMDEAV-------AGHANFIDVNL 17989021 GLEPVRLRPGMYIGG-TDEK----ALHHLFAEVIDNSMDEAV-------AGHANFIEVTV 23008007 GLEPVRRRPGMYIGG-TDER----ALHHLFAEVIDNSMDEAV-------AGHASFIELEL 22964421 GLEPVRRRPGMYIGG-TDEK----ALHHLFAEVIDNSMDEAL-------AGHATFIEVEL 13471034 GLEPVRRRPGMYIGG-TDDK----AMHHLFAEVIDNSMDEAV-------AGHATFIDVEL 23014487 GLEPVRRRPGMYIGG-TDDR----ALHHLVAEVLDNSMDEAV-------AGHAGWIELEL 22966144 GLEPVRRRPGMYIGG-TDER----ALHHLVAEILDNAMDEAV-------AGYAQVIDIDL 7437466 GLEPVRKRPGMYIGG-TDER----ALHHMVAEILDNAMDEAV-------AGHANRIEVEV 22960431 GLEPVRKRPGMYIGG-TDER----ALHHLVAEILDNSMDEAV-------AGHATRIEVEL 23108729 GLEPVRRRPGMYIGG-TDER----ALHHLAAEVLDNAMDEAV-------AGHANRIEVLL 16126217 GLEPVRKRPGMYIGG-TDER----ALHHLFAEVLDNSMDEAV-------AGFAKTIEVKL 4033401 GLEPVRLRPGMYIGG-TDSK----ALHHLFSEIIDNAMDEAV-------AGYADLIDITL 15892232 GLEPVRKRPGMYIGG-TDSN----AMHHLVSEVLDNAMDEAV-------AGFASIITITM 15604098 GLEPVRKRPGMYIGG-TDSN----AMHHLVSEVLDNAMDEAV-------AGFASIIMIKM 23001295 GLEGIRKRPGMYIGG-TDLR----ALHHLVAEVLDNAMDEAG-------EGHADKITLTL 15834657 SLDHIRLRAGMYIGRLGDGSQSEDGVYTLFKEVVDNAIDEFV-------MGHGHTIFITG 15605394 SLDHIRLRAGMYIGRLGDGSQAEDGIYTLFKEVVDNAIDEFV-------MGYGHTIHITG 23138218 WKEHIRLRPGMYIGKLGDGSAQDDGIYVLVKEIIDNSIDEHM-------MGNGKQIDIVI 15888043 AIKQ---LSETLINQIAAGEVIERPS-SATKELVENAIDAGA---------TRIEIATAG 15964569 AIKQ---LSETLINQIAAGEVIERPA-SAAKELIENALDAGA---------TRIEIATAG 17989371 TIRH---LSETIINQIAAGEVIERPA-SVIKELVENAIDAGA---------TRIEVVTAG 13476839 PIRQ---LSETMINQIAAGEVIERPA-SVVKELVENALDAGA---------SRVEVVTAG 22961545 PVRQ---LPETIVNRIAAGEVVERPA-SVVKELVENAIDAGA---------SRIDIFSDG 22956645 VIRQ---LDEAAINRIAAGEVVERPA-SAVKELVENALDAGA---------RRIAVDIAC 23010126 PVRR---LDPILVDRIAAGEVVERPA-SAVKELVENAIDAGA---------RSVEVAIEG 16124948 PIRR---LPPETVNRIAAGEVVERPA-SAIKELVDNAIDAGA---------TRIEVEAHG 23015547 SIRL---LPPTLVNQIAAGEVVERPA-SAVKELVENAIDAGA---------TRIDVVLAE 23109150 VIRR---LPETLINRIAAGEVVERPA-SALKELVENAIDAGS---------SHVHVRLSE 15789473 RIRA---LDDATVARIAAGEVVERPA-SVVKELVENSLDAGA---------ASVDVSVDA 23104554 RIQ---LLSLRLANQIAAGEVVERPA-SVAKELLENSLDAGA---------RRVDIEVEQ 15600139 RIQ---LLSPRLANQIAAGEVVERPA-SVAKELLENSLDAGS---------RRIDVEVEQ 23060778 RIE---LLSPRLANQIAAGEVVERPA-SVIKELLENSLDSGA---------KRIDVDVEQ 23026526 EIK---KLSPRLANQIAAGEVVERPA-SVIKELVENSVDAGA---------KQLDVEIEN 15804759 PIQ---VLPPQLANQIAAGEVVERPA-SVVKELVENSLDAGA---------TRIDIDIER 5107506 PIQ---VLPPQLANQIAAGEVVERPA-SVVKELVENSLDAGA---------TRIDIDIER 16763178 PIQ---VLPPQLANQIAAGEVVERPA-SVVKELVENSLDAGA---------TRVDIDIER 16767605 PIQ---VLPPQLANQIAAGEVVERPA-SVVKELVENSLDAGA---------TRVDIDIER 16120706 PIQ---ILPPQLANQIAAGEVVERPA-SVVKELVENSLDAGA---------TRIDIDIER 15640372 TIR---ILPARLANQIAAGEVVERPA-SVVKELVENSLDAGA---------TRIDIDLEK 15602769 AIK---VLSPQLANQIAAGEVVERPA-SVVKELVENSLDAGA---------TRIQIDIEN 22983410 PLRAIQPLPDQLISQIAAGEVVERPA-SVVKELLENALDAGA---------QSLRILLDE 13446680 PLRAIQPLPDQLISQIAAGEVVERPA-SVVKELVENALDAGA---------GTLRILLDE 22976701 PIR---PLPDQLISQIAAGEVVERPA-SVVKELLENALDAGA---------TQLGIRLEE 17547282 PIR---PLPDQLISQIAAGEVVERPA-SVVKELLENALDAGA---------TQLQIKLEE 21243139 AIR---QLPEILINQIAAGEVVERPA-SVVKELVENALDAGA---------TRVDIELEE 21231736 AIR---QLPEILINQIAAGEVVERPA-SVVKELVENALDAGA---------TRVDIDLEE 15837362 PIR---QLPEILINQIAAGEVVQRPA-SVVKELVENAIDAGA---------TRVDIELEA 22995446 PIR---QLPEILINQIAAGEVVERPA-SVVKELVENAIDAGA---------TRVDIELEA 15677300 RIA---ALPDHLVNQIAAGEVVERPA-NALKEIVENSIDAGA---------TAIEVELAG 15794549 RIA---ALPDHLVNQIAAGEVVERPA-NALKEIVENSIDAGA---------TAIDVELDG 22955594 PIK---LLPDGLISQIAAGEVIERPA-SVLKELLENAIDAGT---------TDISVNIAQ 15639295 PIH---RLSPDTAKKIAAGEVIERPA-SVVRELLENALDAGA---------TKIHLEINA 21401749 -IRK---LDDQLSNLIAAGEVVERPA-SVVKELVENSIDANS---------TSIEIHLEE 16078768 -VIQ---LSDELSNKIAAGEVVERPA-SVVKELVENAIDADS---------TVIEIDIEE 16800509 HIVE---LTDALSNKIAAGEVVERPA-SVVKELVENAIDAGS---------TVIDILVEE 16803444 HIVE---LTDALSNKIAAGEVVERPA-SVVKELVENAIDAGS---------TVIDILVEE 15614931 -IIK---LDDHLSNKIAAGEVVERPA-SVVKELVENALDANS---------RKITIEVEA 23099087 PIIQ---MPDALANKIAAGEVVERPA-SVVKELLENSIDAGA---------TWIRVEIKE 14577936 KIIE---LNEALANQIAAGEVVERPA-TVVKELVENSIDAGS---------SKIIINVEE 15674190 KIIE---LNEALANQIAAGEVVERPA-SVVKELVENSIDAGS---------SKIIINVEE 22538232 KIIE---LPDILANQIAAGEVVERPS-SVVKELVENAIDAGS---------SQITIEVEE 15675871 NIIE---LPEVLANQIAAGEVVERPA-SVVKELVENAIDAKS---------SQITVEIEE 14279172 KIIE---LPEVLANQIAAGEVVERPA-SVVKELVENAIDAGS---------TQITIEVEE 15900110 HIIE---LPEMLANQIAAGEVIERPA-SVVKELVENAIDAGS---------SQIIIEIEE 22991198 KIQE---LSERLANQIAAGEVVERPA-SVVKELVENAIDAGS---------TQIDILVEE 15924287 KIKE---LQTSLANKIAAGEVVERPS-SVVKELLENAIDAGA---------TEISIEVEE 23002387 KIHE---LSPELTNQIAAGEVIERPA-SVVKELCENSLDAGS---------SRIRINFID 23023443 RIHE---LSNLLANQIAAGEVIERPA-SVVKELVENAIDAGA---------TQIDVIVEE 22971740 PIRL---LDETIAAQIAAGEVVERPA-SVVKELLENAIDAGA---------QRIVIEVRG 23112898 --------------------MVERPV-SVVKELIENALDAQA---------TQIEVIIEG 15895111 RINI---LSEDTSNKIAAGEVVERPF-SVVKELVENSIDAGA---------KTINIEIEN 18310138 RINI---LNADTANKIAAGEVVERPS-SVVKELVENSLDAGA---------KNITIEIQN 23021245 RIII---LDENTANQIAAGEVVERPA-SVVKELVENSIDAGS---------TNISVEINN 20807805 KIHL---LDEKTVNKIAAGEVVERPA-SIVKELVENSIDAGS---------KNITVEILE 20089411 KIRI---LDRDTINKIAAGEVIERPA-SVVKELVDNSIDAGA---------TEIRIEVEK 21227784 KIRI---LDKDTINKIAAGEVIERPA-SVVKELVDNSIDAGA---------TEIRIEVEK 23051231 KIRL---LDKDTINKIAAGEVIERPA-SVVKELIDNSIDAGA---------TDIRIEVEK 19703797 RIRI---LDESVSNAIAAGEVVENPT-SMIKELIENSLDAGS---------KEIKLEVWN 21674838 IAR----LPDIVANKISAGEVVQRPA-SVVKELIENSIDAGA---------SRITVIIKD 23137831 IIRL---LPDNIANQIAAGEVVQRPA-SVVKELLENSVDAGS---------TNIQLIVKD 23053836 QIRI---LPENLTNKIAAGEVVERPA-SVVKELVENSLDAGC---------RDIIVEIEA 23000602 RVQQ---LPETLANQIAAGEVVERPA-SVIKELVENSIDAGA---------SLIEVKAEQ 15617161 PIRI---LPSDLSSQISAGEIIERPA-SVVKEIIENSIDAGS---------KNINIIVEN 21672810 PIRM---LSSSLSSQISAGEVIERPS-SVIKELLENSIDAQA---------KNIDISVER 15893284 TIKF---LSESTINRIAAGEVIERPA-SVVKELVENAVDASS---------TKIDIILER 15604708 TIKF---LSESTINRIAAGEVIERPA-SVVKELVENAIDGGS---------TKIDIILER 15606703 FVKL---LPPEVRKVIAAGEVIESPV-DVVKELVENSLDAKA---------TKVEVEIVK 3914082 FVKI---LPPEVRRKIAAGEVIDAPV-DVVKELIENSLDAKA---------TRIEIEVVK 15642797 RIKR---LPESLVRKIAAGEVIHNPS-FVLKELVENSLDAQA---------DRIVVEIEN 15835478 SSR-IRLLDSATVNQIAAGEVIENAA-SVVKELIENALDAGA---------DEISIETLG 15605304 PSR-IRLLDSVTVNQISAGEVIENAA-SVVKELIENSLDAGA---------DEIHIETLG 15618721 TRRPIQLLDPLTINQIAAGEVIENSV-SVVKELIENSLDAGA---------DEIEIETLG 23124554 IIQA---LPTEVVYLITAGEVIDSLA-SVVRELVENSLDAGA---------TRIVVSLWP 17230547 TIQA---LPQEVVYLITAGEVIDSFA-AVVRELVENSLDAGA---------NRIVVYLWP 23040870 QIQT---LPKEVVSLIAAGEVIDSLA-AVVRELVENSLDAGA---------TRIIVSIIS 16329972 MIQV---LDRQLVDLIAAGEVIDSPL-AVVRELVENALDAGA---------DRILVRVWW 15806699 PIHV---LPPHVARLIAAGEVVSRPL-DVVRELVENALDAGA---------SRIEIEVDG 15594556 KIRF---LDKYLVQKIAAGESIDRPC-SILRELLDNSIDSGA---------TKIEVFLEE 21287814 VIRK---LDEVVVNRIAAGEIIQRPA-NALKEMIENSLDAKA---------TSITITVKA 17136968 VIRK---LDEVVVNRIAAGEIIQRPA-NALKELLENSLDAQS---------THIQVQVKA 13878583 VIRR---LDETVVNRIAAGEVIQRPA-NAIKEMIENCLDAKS---------TNIQVVVKE 13591989 VIRR---LDETVVNRIAAGEVIQRPA-NAIKEMTENCLDAKS---------TNIQVIVRE 4557757 VIRR---LDETVVNRIAAGEVIQRPA-NAIKEMIENCLDAKS---------TSIQVIVKE 460627 RIKA---LDASVVNKIAAGEIIISPV-NALKEMMENSIDANA---------TMIDILVKE 19112991 KIRP---LDQLVINKIAAGEIIERPE-NAIKELIENSLDAGS---------TSIDVLLKD 11357265 KIQR---LEESVVNRIAAGEVIQRPV-SAVKELVENSLDADS---------SSISVVVKD 20146218 RIRR---LEESVVNRIAAGEVIQRPS-SAVKELIENSLDAGA---------SSVSVAVKD 13517948 GIER---LPEDVINRIAAGEVVQRPS-AALKELLENSLDAGS---------TCIQVVVQD 17554324 LIQR---LPQDVVNRMAAGEVLARPC-NAIKELVENSLDAGA---------TEIMVNMQN 19173567 EIKR---LPSDVISRISAGEVITRPY-NILKETIENSLDANS---------THITIKMEQ 17136970 QIKA---IGKDTVHKICSGQVVLSLA-VAVKELVENSIDAGA---------TLVEIKLKD 3193224 QIKA---IGKDTVHKICSGQVVLSLA-VAVKELVENSIDAGA---------TLVEIKLKD 21291966 KINA---IDKETVHRICSGQVVLNLA-IAVKELVENSLDAGA---------TLIEVKLRG 1304121 AIKP---IDRKSVHQICSGPVVPSLS-TAVKELVENSLDAGA---------TNIDLKLKD 4239950 AIKP---IDRKSVHQICSGPVVPSLS-TAVKELVENSLDAGA---------TNIDLKLKD 1082696 AIKP---IDRKSVHQICSGPVVPSLS-TAVKELVENSLDAGA---------TNIDLKLKD 1082697 AIKP---IDRKSVHQICSGPVVLSLS-TAVKEIVENSLDAGA---------TNIDLKLKD 4885551 AIKP---IDRKSVHQICSGPVVPSLRPNAVKELVENSLDAGA---------TNVDLKLKD 22046253 ------------------------------------------------------------ 22046611 --------------------------------MVENSLDAGA---------TNIDLKLKD 18568033 ------------------------------------------------------------ 4239952 AIKP---IDRKSVHQICSGPVVLSLS-TAVKKIVGNSLDAGA---------TNIDLKLKD 17942771 AIKP---IDRKSVHQICSGQVVLSLS-TAVKELVENSLDAGA---------TNIDLKLKD 21619309 AIKP---IDRKSVHQICSGQVVLSLS-TAVKELVENSLDAGA---------TNIDLKLKD 17942780 AIKP---IDRKSVHQICSGQVVLSLS-TAVKELVENSLDAGA---------TNIDLKLKD 20848664 AIKP---IDGKSVHQICSGQVVLSLS-TAVKELIENSVDAGA---------TTIDLRLKD 6679397 AIKP---IDGKSVHQICSGQVILSLS-TAVKELIENSVDAGA---------TTIDLRLKD 12851890 ------------------GQVVLSLS-TAVKELIENSVDAGA---------TTIDLRLKD 1082698 AIKP---IDRKSVHQICSGPVVLSLS-TAVKELVENSLDAGA---------TNIDLKLKD 7487015 LIRP---INRNVIHRICSGQVILDLS-SAVKELVENSLDAGA---------TSIEINLRD 172203 QIHQ---INDIDVHRITSGQVITDLT-TAVKELVDNSIDANA---------NQIEIIFKD 19880897 QIHQ---INDIDVHRITSGQVITDLT-TAVKELVDNSIDANA---------NQIEIIFKD 19880904 QIHQ---INDIDVHRITSGQVITDLT-TAVKELVDNSIDANA---------SQIEIIFKD 19115329 TVKP---IDANTVHKICSGQVITDVA-SAVKELVENSLDSGA---------TTIEIRFKN 14250028 -------------------QIITSVV-SVVKELIENSLDAGA---------TSVDVKLEN 4505911 --------PAATVRLLSSSQIITSVV-SVVKELIENSLDAGA---------TSVDVKLEN 20810039 --------PAATVRLLSSSQTITSVV-SVVKELIENSLDAGA---------TSIEVKLEN 22204384 -MKA---LPPETVRLLCSSQVITSVL-NVVKELIENSLDAGS---------SSLEVKLEN 17562796 KIER---ISKEVAERLTTAQVVVSLS-SAIRQLIDNSIDAGS---------TIIDIRVKN 15237032 ------------------GIIMFDMA-RVVEELVFNSLDAGA---------TKVSIFVG- 13027781 ------------------GQVITNLS-SVVKELVENSLDAGA---------RTVAIRVED 19074926 ----------------------VQSIYIVVKELIENAIDSG-------------CTWIRI 12964795 ------------------------------------------------------------ 22971450 -----------------------------LVHLIRNAVDHGLE-------PPDERIAQGK 23133974 ------------------------------------------------------------ 21229586 ------------------------------------------------------------ 19703117 ------------------------------------------------------------ 14602026 ----------------------------------------------------------GL 20850207 ------------------------------------------------------------ 3023302 ------------------------------------------------------------ 15223829 --------------------------------------------------GYEKPVEFGL 23054515 ---------------------------------------------------TCATCHSSS 2251101 -------------------------------------------------FNKNGYCTNNI 23107981 ------------------------------------------------------------

16081092 AEDAVRLVRNRAEA-----------------------------------------AGLKL 16126721 AEDAVRLVRNRAEA-----------------------------------------AGLKL 22963829 LLNCCNLLALKARD-----------------------------------------SGIDL 22989182 VDNAVGLLAGRAHE-----------------------------------------KGLKV 17547798 LDSTVGLLASRAHE-----------------------------------------RSLAV 22979217 FANVLSLLAPRAQA-----------------------------------------KGLQL 23013649 VRAAARLLEHKSVV-----------------------------------------SGVDF 22967281 VASVHRLVNQRAEA-----------------------------------------AGVRL 22998770 LQSVVDLLENLARE-----------------------------------------RGLAL 23125239 VSEVSQELTPLAEE-----------------------------------------KGLAL 22998928 LRSVSTLLEPSAKH-----------------------------------------KGLSV 22999655 IKEVVGLVAVLASE-----------------------------------------KNLLL 22999372 LESLTNLIAVKARE-----------------------------------------KGLEL 23016213 MDNLANLVGLKAED-----------------------------------------RGLEL 23001019 LSNVANLVSMKVEE-----------------------------------------KGLEI 23102095 TDHLADLSVLKAQE-----------------------------------------KGLEL 23016211 LENVGNLISDKASA-----------------------------------------KGLEL 16330584 LDNVATLISEKATN-----------------------------------------KGLEL 15641361 LDNVTAVVSLKAQE-----------------------------------------KGIEF 22998978 FDHLSTMISQKAHE-----------------------------------------KGLEV 22998577 LSNLATLTAVKAQE-----------------------------------------KQIEL 22999846 LDTLATLTSVKADE-----------------------------------------KGLAL 23000440 LASLADLMSIRADE-----------------------------------------KKIEL 22999533 LDSVAALNANRAEE-----------------------------------------KGLDL 22999650 ISRVMRLQGLKAQD-----------------------------------------KNVEL 22999289 ISNVANIAIARKED-----------------------------------------KDLDL 16330590 MGNLHSILGIQAEA-----------------------------------------KGLTL 22998460 MEEVVALLAPRAQD-----------------------------------------KGVAL 22999474 IANINAILGHKAVQ-----------------------------------------KELSI 23000229 LKQLAANVLPAMRN-----------------------------------------KAVEV 23001466 LQQIAQMLAPQAQA-----------------------------------------KGLHF 23000654 LKGVHDLFLPRATA-----------------------------------------KGITL 23027858 VFNALKTLAVKETE-----------------------------------------KFLDL 22963532 VFNALKTLAVKANE-----------------------------------------KFLDL 13591555 VFNALKTLAVKAND-----------------------------------------KFLDL 16904238 VFNALKTLAVKANE-----------------------------------------KFLDL 5225252 VFDALKTLAVKANE-----------------------------------------KFLDL 16329802 VFDALKTLAVKANE-----------------------------------------KFLDL 20198952 LYDALKTLSWRAHQ-----------------------------------------KCIEL 23053202 IRQLTDITSVKASS-----------------------------------------KGVTY 21885294 MQDIGLVFSSSAEQ-----------------------------------------KGLEV 21243225 FDNIADLMRSSLSA-----------------------------------------KPVEM 21231797 FDNIADLMRSSLSA-----------------------------------------KPVEM 23102206 LSDTLNLFTAQAME-----------------------------------------KRLRL 15598658 LSDTLALFSAQAVE-----------------------------------------KRLHL 23020868 LEKTYKAHIVQANE-----------------------------------------KGLRL 23112091 IEQIIKTHSPEAER-----------------------------------------KGLDL 23053622 VESLRRLFAVKAER-----------------------------------------ENISL 23055398 VEGALDVVAPQAHG-----------------------------------------KGLEL 23020543 LQDTLTILAPAAHA-----------------------------------------KQLEL 1346440 LQDTLTILAPAAHA-----------------------------------------KQLEL 463195 LQDTLTILAPAAHA-----------------------------------------KQLEL 14906039 LQDTLTILAPAAHA-----------------------------------------KQLEL 10178628 LQDTLTILAPAAHA-----------------------------------------KQLEL 23059895 LQDTLTILAPAAHA-----------------------------------------KQLEL 2439990 LQDTLTILAPAAHA-----------------------------------------KQLEL 808104 LQDTLTILAPAAHA-----------------------------------------KQLEL 13641117 LQDTLTIFAPAAHA-----------------------------------------KQLEL 15596125 IQDALTMLAPAAHE-----------------------------------------KQLEL 23102809 IQDTLTILAPAAHA-----------------------------------------KHLEL 23105439 LADVVGMLADKAAD-----------------------------------------KGLPL 23001649 VEDVTALLAQRVDS-----------------------------------------EKLEL 23027374 LEDCVQMFSASTDK-----------------------------------------RNIEL 23026365 LSDVVQSFNYSAQE-----------------------------------------KGIEL 23027857 LEDIAHAMAGRALE-----------------------------------------RGNEL 23014385 VEGVADLLTIRAQE-----------------------------------------KGISL 23015108 VESVVDILAPRAHA-----------------------------------------KGIEI 21241265 LDGVIQLLQRTAEG-----------------------------------------RQLRL 21229958 LDGVAQLMQRTAEG-----------------------------------------KQLRL 16329648 IETVLEMFGPIARA-----------------------------------------KHLEL 3955036 IETVLEMFGPIARA-----------------------------------------KHLEL 23126935 LEEVLELLAPSAHN-----------------------------------------KGLEI 17231253 VEEVLDLLAPQAHS-----------------------------------------KGLEI 17229771 VEEALDLLAPQAAS-----------------------------------------KGIEL 22298825 VEDVLSLLASKAQE-----------------------------------------KELEL 22298419 VEEVLDLLASRAAE-----------------------------------------REVEL 17230367 VEQVIDLLAAKAAQ-----------------------------------------KDIEL 16761737 LDEVVTLLAHSSHD-----------------------------------------KGLEL 16766264 LDEVVTLLAHSSHD-----------------------------------------KGLEL 15803307 LDEVVTLLAHSSHD-----------------------------------------KGLEL 2073556 LDDVVMLLAHTAHE-----------------------------------------KGLEL 2463029 LDDVVMLLAHTAHE-----------------------------------------KGLEL 16123530 LDEVIILLAHTAHE-----------------------------------------KGLEL 15642449 LEEVVNLQATSAHE-----------------------------------------KGLEI 23053150 LERTAQLIAWQAGR-----------------------------------------KGLEL 23000161 VSEAEQIVAFQIRK-----------------------------------------QGIRF 23000657 VYDAGEVIRFRSHE-----------------------------------------KGLHQ 23026553 IEDTLKLQTPAANE-----------------------------------------KNIRM 23013889 CQAVIHMLSVAAN------------------------------------------DDVDI 13472804 ADNIIELLAARAFA-----------------------------------------KDIGL 22999284 VHETMEMLSFKAKD-----------------------------------------KGLAL 16124840 IAETVALLSVQADR-----------------------------------------KGLSL 16124905 IDDTVRMFGLHAAE-----------------------------------------KNLQI 23001602 IHSVVEVNTITANQ-----------------------------------------QGLPI 22998518 LESVMDMASYRATE-----------------------------------------KGIKL 22979714 IEDVLRIQARQIEK-----------------------------------------KGVIL 23012559 VEGVVSLLRGRATE-----------------------------------------KNLTL 23012953 VEEVRLVLTSRVAE-----------------------------------------KDLTL 15601465 VSETHELMQSRARE-----------------------------------------KGITL 15600175 LEDVLTLLEPRARE-----------------------------------------NATRL 22962312 IEDIIELLAPRAQA-----------------------------------------RGLEI 16124282 VRGVARLLATQAAH-----------------------------------------KGLRL 16127421 LRGVADMLRAQAET-----------------------------------------KGLYL 16126740 ASSCAGLVAERAEA-----------------------------------------KGLAV 16127449 AQSIRETFVPQARA-----------------------------------------KGLAF 16127218 LGDLRALWTPAATD-----------------------------------------KGLDL 16127332 ALQTRAVWSESARL-----------------------------------------KGLDL 22998767 VEEVCEVVTSSAHD-----------------------------------------KGLIL 23014840 VDSVVQTISPAAAA-----------------------------------------KSLSI 22954099 VERACGTLTHMAAS-----------------------------------------KEVEL 22961592 VESVRAIIEPEVRG-----------------------------------------KGIEL 22963653 VDNTLSVIGPRAIA-----------------------------------------KGLVI 23000388 LLNLLEVMQPQARN-----------------------------------------KELDL 22959449 LDDVARMMQPLVRR-----------------------------------------KPQLR 22967730 LNGVFALVAPSAHR-----------------------------------------KGLEV 13473203 IEDVATLVSTRAKE-----------------------------------------KDLEL 13473249 VEDVATLVSARVAE-----------------------------------------KNLEL 22958049 IHEVAMLLQPKARA-----------------------------------------KGIDL 21398939 AASMHQNFLHIAAQ-----------------------------------------KNVEF 22988264 LQALEEMFKPMAAA-----------------------------------------RQLRL 13472176 RQHMDRTFRQLAAD-----------------------------------------KGLGF 23125110 ETSLEQTFRQVAHN-----------------------------------------KELSF 21224094 VDYVEATFRPLSAE-----------------------------------------KGLDL 21225602 IEYVEATFRPMTSQ-----------------------------------------KGLEF 23019494 VDYVEASFRPLASE-----------------------------------------KGLAF 23020660 MEDLRQMFESSAKE-----------------------------------------KNISF 22999729 VEELEPLFRDSAQE-----------------------------------------KKIEL 21242035 LQRLRDTFEPLARQ-----------------------------------------KGLAL 21230642 VQRLRDTFEPLARQ-----------------------------------------KGLQL 22998198 ----CSVLRLQAEQ-----------------------------------------KGLSL 23000653 MRETCEVMGYAAAK-----------------------------------------KKLEM 23000375 VEDLLGFFQLPYHE-----------------------------------------KGIAL 23000437 VVETCQLFQVQCRK-----------------------------------------QGIEL 23001024 IEDTIAIFQMQAKL-----------------------------------------KGLTL 22999127 FLLICDIVRLQAQE-----------------------------------------KGLTF 22999563 FIEIQDLFRQQAIK-----------------------------------------KNLAF 22999905 VISITDFFRLQALN-----------------------------------------HNLSL 23000166 VEETMSMMSIVADQ-----------------------------------------KGLRL 22999962 VEEITQIKRVAAEH-----------------------------------------KGVRL 23014204 VAEAASVHHSAAQA-----------------------------------------KGITL 22998278 VEHVMDILRHKASE-----------------------------------------KGLQL 23000401 LKSLITMLRPMARD-----------------------------------------KGLSM 22999159 VGDVCSLFGYEAQS-----------------------------------------KGLAL 22999727 LQEVEELFTFSALA-----------------------------------------KGITL 22998631 VEGAVEIFTLRTQE-----------------------------------------KGVKL 22998646 MANLGDMLTLRAQE-----------------------------------------KGVKL 23126479 LQSVVEICRIKAEQ-----------------------------------------KSIEF 23128323 LQSVVEICRIRADQ-----------------------------------------KGISF 23130312 IDSVTEICRIRAEQ-----------------------------------------KVIAF 17228134 MQGVVEICHIRVQQ-----------------------------------------KGIEF 23129372 LTTTVEICRIKAEQ-----------------------------------------KGIAF 17228884 IQGIAEICQIRAAQ-----------------------------------------KDILF 23127221 LDRLQQMFALKAQS-----------------------------------------RGLQL 23129844 LENLEEMLRFRATS-----------------------------------------KGLEL 16330678 LDNLQALFQLRAQE-----------------------------------------KQLLL 22298910 LRDLEEMLKVRAEA-----------------------------------------KGLRL 23000906 LDDLSAMMVAKARV-----------------------------------------KQVDL 15889688 LDQVVDMFRPQAQA-----------------------------------------KGLEF 23011796 LAQIVDMVRLQAEA-----------------------------------------AGLSF 15803750 LADLENLSALQAQQ-----------------------------------------KGLRF 16131100 LADLENLSALQAQQ-----------------------------------------KGLRF 16762090 MADLENLSGLQAQQ-----------------------------------------KGLRF 7212861 LNDIYNFASFLAKE-----------------------------------------KNLIF 15602178 LNDISNVARLLAQQ-----------------------------------------KKLAF 1122856 LESTLQLMSGRVKG-----------------------------------------RPIRL 15800913 LESTLQLMSGRVKG-----------------------------------------RPIRL 16120593 LDQAMLTIHSQALS-----------------------------------------KSLAL 21243758 VGQAVELVRPSAEQ-----------------------------------------KQLAF 21232279 IRQVVDLVRPSAEQ-----------------------------------------KQLAF 23121089 VAQAADLMRPLAQQ-----------------------------------------RGLVF 21243755 VAEVEALMAPLAQE-----------------------------------------RGLRF 21243756 VAEVGALMAPLAQE-----------------------------------------RGLRF 21232278 TQELADFMHPIVEA-----------------------------------------RGLRF 23101880 AMQIESSLYLGAQS-----------------------------------------KRLTL 20090861 ISHIINLLSGKAGS-----------------------------------------KGLKL 23135284 IKSAIQTLTYKAEE-----------------------------------------KGIDL 16330151 IREIKQIFDYKAES-----------------------------------------KSLLL 1679757 IEDVNELVSTMAIA-----------------------------------------KRLEL 22086084 VDEVYQILSSANLVNA--------------------------------------SKELDL 22967903 LQDVIGLFLPKASE-----------------------------------------RGLVL 19115322 IADCIELVYPSLSS-----------------------------------------KPVQI 23103341 IEDATALLSQS-AA-----------------------------------------PGVEL 23058955 IEDTANLLSQN-AA-----------------------------------------PSVEL 15599307 MQDLAVVLSGNQGD-----------------------------------------KDVEV 22968449 LRDLAVVLSGSYGD-----------------------------------------KGVEV 15596808 VQGSALVFQHSAQQ-----------------------------------------RGLAL 23059907 IGACAQSFQHSAAQ-----------------------------------------RGLAL 22999065 IQDGIELHKLLAHE-----------------------------------------KGIDL 22999855 VEDVCACLSERAQG-----------------------------------------KGVGL 16761198 MNHITANYLPLVVR-----------------------------------------KQLGL 16765598 MNHITANYLPLVVR-----------------------------------------KQLGL 147525 MNHITANYLPLVVR-----------------------------------------KQLGL 15598240 VESVRRMFEGLARQ-----------------------------------------KGLRL 23058959 VGSVVRIFEGLARQ-----------------------------------------KQLSL 17231257 INAVVMEMRSLAEA-----------------------------------------KKLSL 4336932 INNVVLTVKPAIEK-----------------------------------------NANVL 17231988 INNVVVTVKPTIEK-----------------------------------------NNNLL 23041286 IENVLATIQPLIEQ-----------------------------------------NNNIL 22974516 INEVVMTLQGLAKQ-----------------------------------------GQNTI 22972340 LEETLRTAQALIND-----------------------------------------RPIQL 23125546 ITQAVNVIQPLADK-----------------------------------------AGVTL 17229920 IESAVSIMQPLANK-----------------------------------------AGVKL 17232665 MTQSVEVMEELAEQ-----------------------------------------AGIQL 22972652 CRNAIDDLASFARQ-----------------------------------------QQVTI 23125524 LDWATNSTAGLFET-----------------------------------------NGLQL 17228319 LDWAANSTAALFET-----------------------------------------NGLQL 10957449 IFEDAAGFPPLT------------------------------------------------ 23055072 VQKVTQSVAGLVDK-----------------------------------------KGLRL 1352397 FREVLNLIKPIAVV-----------------------------------------KKLPI 22095655 FREVLNLIKPIAVV-----------------------------------------KKLPI 22095657 FKEVLNLIKPVTLV-----------------------------------------KKLSL 22095684 FKEVLNLIKPVTLV-----------------------------------------KKLSL 15131529 FIEVHNLVKPVASV-----------------------------------------KKLSV 18252319 FREVHNMIKPVASI-----------------------------------------KRLSV 14572558 FREVHNMIKPVASI-----------------------------------------KRLSV 18252341 FREVHNLIKPVASV-----------------------------------------KKLSV 21666555 FREVHNLIKPVASV-----------------------------------------KKLSV 22095685 LREVHNLIKPIASV-----------------------------------------KKLCI 22095686 FRQVFNLIKPIASV-----------------------------------------KKLFI 20091095 FREVLNLIKPVAAV-----------------------------------------KKLFV 17231039 FREVLNLIKPVAAV-----------------------------------------KKLFV 22095654 FREVLNLIKPVAAV-----------------------------------------KKLFV 17646113 FREVLNLIKPIASV-----------------------------------------KKLFV 17646115 FREVLNLIKPIASV-----------------------------------------KKLFV 22095659 FREVHSLIKPIASV-----------------------------------------KKLFV 7407123 FKEVLNLIKPIASV-----------------------------------------KKLLV 7547007 FREVLYLIKPIASV-----------------------------------------KKLFV 15598020 LREAVNLIKPIASL-----------------------------------------KKLSI 21232277 LREAVNLIKPIASL-----------------------------------------KKLSI 4210924 LREAVNLIKPIASL-----------------------------------------KKLSI 7652766 LREAVNLIKPIASL-----------------------------------------KKLSI 4154359 FREVVNLIKPIAAV-----------------------------------------KKLSL 4650821 FREVVNLIKPIAAV-----------------------------------------KKLSL 4164161 FREVINLIKPIASV-----------------------------------------KKLAL 4138853 LGEIVELIKPIASV-----------------------------------------KKLPI 20090015 IEEVRRVLSSLSAE-----------------------------------------KNIRI 21228280 IEEVQRVLSPLSAD-----------------------------------------KNIII 20091382 LNSIKNLLSPIADR-----------------------------------------KMIEV 21229203 LNAIKSLLSPIADR-----------------------------------------KNIEI 21228731 LNSVKSLLSPIAAR-----------------------------------------KNIKI 20092182 LELIRNVLYPVADK-----------------------------------------KNIDI 20091132 ISEVKVLLTPLASK-----------------------------------------KDIQI 21227050 IGEVRMNLLSPASV-----------------------------------------KKINV 20091380 FAEVRDMIFPFATS-----------------------------------------KGLKI 21229201 FAEVRDMLFPFAAS-----------------------------------------KGIKL 20093164 FEEVKSTLFPLAQA-----------------------------------------KSLEI 23052557 FEEVKAVLFPLIQA-----------------------------------------KPLEV 23052223 FDEVKSTILPLSQV-----------------------------------------KSLEM 21228983 FSNTKNILSPLALK-----------------------------------------KNISM 21229307 FNDTRAVTSALALK-----------------------------------------KDISM 20090805 FKDIEKVFRPRVSG-----------------------------------------KKLSL 20091183 FDEIKDILFPVFSK-----------------------------------------KKIRI 20092217 INKVISVVLPQAQE-----------------------------------------KNIIL 17980436 FEEAQSLLAPLALD-----------------------------------------KDISI 15641456 LDQSLVYHRQIAQD-----------------------------------------KGVHF 1754642 VSQIVESFRPYCE-----------------------------------------KKALHL 17232455 VSQIVESFRPYCE-----------------------------------------KKALHL 23126551 VSQIVESFRPYCE-----------------------------------------KKRLHL 18030059 IQTAVSSVAPQAQ-----------------------------------------RKGVEL 2765035 ISAAIETVQLAAQ-----------------------------------------AKSIQI 23126883 IESAIDTVNTAAI-----------------------------------------AKSIQL 23127256 IEVALDTVRLAAQ-----------------------------------------AKSIEL 23125853 ILSALETMRLAAE-----------------------------------------TKLIEV 17227678 ILAALETMRLAAE-----------------------------------------SKLIQV 23128069 VEAALETVRLAAQ-----------------------------------------AKSIQI 17230934 IGAAIDTVRLAAE-----------------------------------------AKEIKI 23124340 IEAGLETVRLAAE-----------------------------------------AKDIQI 23126892 IAGALETVRLAAE-----------------------------------------AKSIQI 17232702 VQAGLETVRLAAE-----------------------------------------AKSIEI 23127009 IEAAIETVRLSAQ-----------------------------------------AKSIEI 17228473 IAAALETVQLAAE-----------------------------------------AKNIHI 23125940 IAAANETVALAAE-----------------------------------------AKSIQI 17230767 IEEALETVRLAIE-----------------------------------------AKSIHI 17230584 IEAALETVRLTAE-----------------------------------------SKSIHI 23126274 IDAALETVRLIAE-----------------------------------------SKSIQI 17231477 IQAALDTVRPIAN-----------------------------------------TKSIQI 23123945 ITEAIETLKPQAE-----------------------------------------AKDITI 23129209 IAAALETVRLAAE-----------------------------------------AKAIQL 23125015 MEAALEAVRPLAE-----------------------------------------PKEIQL 17229338 VEAALEAVRPLAD-----------------------------------------TKNMTI 17229296 IETAIENINLAAQ-----------------------------------------AKEIDL 17229208 IEAAIAVVRLAAE-----------------------------------------AKNIQI 23125906 ITAAIEVVQSLAN-----------------------------------------AKDIQL 23126863 VEAAIDTVRPAAE-----------------------------------------AKEINI 21244408 VREALNTQELAAE-----------------------------------------GKDQVL 21233072 VREALGAQEPVAE-----------------------------------------GKDQVL 17549399 LERARETIEPMAR-----------------------------------------QKQITV 21242798 VRSVLELMQPAAL-----------------------------------------TRKIAL 21231592 ARSTVELMQPTAQ-----------------------------------------ARQIRL 22970619 CMSLRPLVADLIR-----------------------------------------RANLSL 22972228 CEASMALVKEQAT-----------------------------------------KKQIHL 23125527 CNYAIWTVRDRAS-----------------------------------------EKGLKL 16331636 CLAVISMVQTKAK-----------------------------------------EKQLAL 17229180 AENTIESLLEKALSE---------------------------------------QVNLKL 8953946 ATQTLNTLQEKARLG---------------------------------------EIQLML 22298442 CADCLEVVKPQAHRH---------------------------------------QVNLRH 17230612 CESSLVFIKQQAL-----------------------------------------QKRIQV 16331796 VNHSLTFVQQFAI-----------------------------------------QKQINL 17231589 CDGSLTFIQQMAL-----------------------------------------KKNICL 23128501 CDSSLSFVKNLAL-----------------------------------------QKNIQL 15614576 VTTVVNVQRFMV-------------------------------------------EAKNL 15640642 TRLVLELSHHLL-------------------------------------------GKKTL 22986735 IQSAVEVCQPII-------------------------------------------DERHH 23121548 AESTVDIFRYLI-------------------------------------------KGRPI 23039579 TEIVLAFSRMIL-------------------------------------------EGKDL 23043880 TEVVLTFSRIIL-------------------------------------------KEKDV 23039991 VESVITLNRVLVG------------------------------------------KNKNL 23027341 VDVVLSLTLPII-------------------------------------------GAKPI 17231003 IEQTLRTYQLNARD-----------------------------------------KGIEL 20270658 IEQTLRTYQLNARE-----------------------------------------KGIEL 22297980 IDQIMRTYQLNAAN-----------------------------------------KSITL 17547175 ITEVVQQFLPDARA-----------------------------------------KGLAL 22972067 VQNVVGQMQPQIRE-----------------------------------------HQLHL 16331345 CQEVLELYQAKFSK------------------------------------------KNLT 22297573 CQETVEDVRLNFER------------------------------------------KKQH 585964 LQQVLEQLHERWRS------------------------------------------KQQQ 22970411 AQQVIDQQRPNAGQ------------------------------------------RDLL 23125172 LMRGLGNLRQRI-N------------------------------------------ETGA 18642520 LNRSLSNLRGRI-H------------------------------------------ETGA 20090134 LNYVLSDLEVSI-K------------------------------------------ENEA 23016161 VERALRALAPKI-E------------------------------------------ECGA 23014799 LDGVIANLSPSI-A------------------------------------------QCGA 17231259 -REVIDSLQP----------------------------------------------PASF 16079368 LEKIIRKFSGVAKE-----------------------------------------KNIAL 22970291 VNEAIRSFTPAANE-----------------------------------------RNVRL 23107696 ------------------------------------------------------------ 22970589 LADLHRQVRRLGEE-----------------------------------------KGIAI 22972926 IERAVERIRPQADR-----------------------------------------KQQVI 22972124 LEAQLAQFEPLFSS-----------------------------------------NQVTL 22972483 IEAAVTRLTPQFTA-----------------------------------------KNIEL 16332022 LAKLQQRFADQLLE-----------------------------------------DGPEL 21397947 FNNIIDRFEMSK-EQN-------------------------------------------- 20808918 IRICIIKFEKRIVEKD-------------------------------------------- 15924682 TRRIIDNMMTQANQKN-------------------------------------------- 21399214 IEDVLDTYEIKFIEKK-------------------------------------------- 23099619 VEEILPQLHQKAENKN-------------------------------------------- 23022358 VRNCVEKVKFESEEK--------------------------------------------- 20807497 AEEVVREIKLIYEGK--------------------------------------------- 20809032 VKNVVNSLSIEATKKG-------------------------------------------- 15614508 VYEVVEQFRYLAAQKR-------------------------------------------- 23020864 VHKIYDEFTPLCQKKS-------------------------------------------- 16801705 IEQSSRTIFEMATEKN-------------------------------------------- 16804538 IEQSARTIFEMATEKN-------------------------------------------- 21673490 LEKTA-ALFEPAAARKG------------------------------------------V 15894978 IKAVCGLLEKSASRKN-------------------------------------------- 18310739 IEKVYMLLNDQAKKKG-------------------------------------------- 20808059 IEDILYIMEKAAKDKS-------------------------------------------- 15643616 VESAVNAIKEFASSHN-------------------------------------------- 15644402 IEYVYRIIQPIAEENE-------------------------------------------- 21402631 LEDIHMVLDNKAGEKE-------------------------------------------- 16079962 LGEIETLLKHKADEKG-------------------------------------------- 15615718 VSEVMTLLKGKAEEKG-------------------------------------------- 23055160 AKRAMELLQPKAARKG-------------------------------------------- 4467966 --RAADTVRPKAGGKG-------------------------------------------- 22970541 VSDVVRR---FAAQVG-------------------------------------------- 23054120 LGELVQQSRLIDPEKG-------------------------------------------- 2126373 ---------SLVCSLVE-------------------------------------SMQDMG 22998334 ---------SMLEQIFA-------------------------------------EHSDMG 22980684 ---------ALLQAIVD-------------------------------------DAQEMG 23110372 ---------ALVADVIG-------------------------------------EFEDMG 22957154 ---------ALVGRVVE-------------------------------------NAQRAG 23108991 ---------VMAQTLVD-------------------------------------TAADEG 22960787 ---------SAMQLITD-------------------------------------QFADIG 15887409 ---------SLIEEVMA-------------------------------------PHREFG 3288072 VLA------ELYERERS-------------------------------------HTASLG 3288065 VLA------ELYERERS-------------------------------------HTASLG 38541207 VLG------EVIAAESG-------------------------------------YEREIN 16762786 VLG------EVIAAESG-------------------------------------YEREIN 79091 VLG------EVIAAESG-------------------------------------YEREIN 16766789 VLG------EVIAAESG-------------------------------------YEREIN 1790910 VLG------EVIAAESG-------------------------------------YEREIN 15803908 VLG------EVIAAESG-------------------------------------YEREIE 3402275 VLG------EVIAAESG-------------------------------------YERVIE 16120480 VLG------EVIAAESG-------------------------------------YERVIE 7521585 LLEAVIELETVIGAEQH-------------------------------------GEVNIE 15642707 IAS------DVASSEGG-------------------------------------YEVQIE 4433394 IAS------DVASSEGG-------------------------------------YEVQIE 23029129 ------------------------------------------------------------ 21225359 ---------AAATRAES-------------------------------------RMPDIE 16760444 ------------------------------------------------------------ 16764817 ------------------------------------------------------------ 15802023 ------------------------------------------------------------ 16122533 ----------------------------------------------------------ER 17547782 ------------------------------------------------------------ 15596355 --------EEIAPLRRE-------------------------------------VLVSCE 23059222 --------EELAPLRAE-------------------------------------VTVQRG 2978442 ------------------------------------------------------------ 2120819 -------------LVRV-------------------------------------MRRLNV 15888314 --------PALERLVRV-------------------------------------MRRLNP 17987619 --------PVLERLHRV-------------------------------------TAKLHP 23012186 --------PALAGLVRT-------------------------------------FGKIYR 23015154 ----------LAELAAA-------------------------------------MRKVHA 22967256 ------------------------------------------------------------ 16125554 --------AVAERLVAV-------------------------------------LERTAD 23012772 ------------------------------------------------------------ 23062762 ---------ELPGLLST-------------------------------------LNMIHG 21244739 --------STAEEIVRG-------------------------------------LEKVYS 21233364 --------PTAEEIVRG-------------------------------------LEKVYA 15836992 --------FTAEEIVRG-------------------------------------LEKVYA 21290140 --------PLIEKLLAS-------------------------------------LAKVYR 2772574 --------PLLDNLISA-------------------------------------LNKVYQ 154267 --------PLLDNLISA-------------------------------------LNKVYQ 16760105 --------PLLDNLISA-------------------------------------LNKVYQ 16764585 --------PLLDNLISA-------------------------------------LNKVYQ 72574 --------PLLDNLISA-------------------------------------LNKVYQ 15801326 --------PLLDNLTSA-------------------------------------LNKVYQ 16129092 --------PLLDNLTSA-------------------------------------LNKVYQ 4103329 --------AVLDGLCSA-------------------------------------LNKVYQ 16121901 --------ALLDSLYSA-------------------------------------LNKVYQ 14133540 --------ALLDSLYSA-------------------------------------LNKVYQ 3237373 --------SLLDSLASA-------------------------------------LHKVYQ 15596377 --------PLVETLCDA-------------------------------------LDKVYR 23058069 --------PVLQSLCDT-------------------------------------LDKVYR 23108708 -------------------------------------------------------AVVRL 23105678 --------SLCRELGLA-------------------------------------LAPLAH 23060595 -----------RELGMA-------------------------------------MAPLAH 15595954 --------ALARELGLA-------------------------------------LAPLAY 22954643 -------------VTDA-------------------------------------FRPDIE 22956336 ------------DLHEL-------------------------------------LEPVAE 22978152 --------HAFRRVLED-------------------------------------LMPLAD 22979925 --------EAFA------------------------------------------------ 16124493 ---------LYENQWRP-------------------------------------GDAPGS 23008220 ---------LGDAVDGA-------------------------------------GSEAAR 15789910 ------------------------------------------------------------ 23012774 ------------------------------------------------------------ 23054444 -----------ELELLL-------------------------------------DFYGTL 17548536 ------------------------------------------------------------ 23112385 IDKTVNMLSPLIQE-----------------------------------------KGISL 20806987 ISDVIDSLAPLAES-----------------------------------------KNVNL 8134668 VSEAISRHKVAADN-----------------------------------------ADIEV 15607631 VSEAISRHKVAADN-----------------------------------------ADIEV 23019099 VEESLDAVRTAADT-----------------------------------------KNIEL 15599971 AEDVLSELARQAID-----------------------------------------KDIEL 16329335 ------------------------------------------------------------ 17158719 VNDLIEEFAALAIA-----------------------------------------SDVTL 17228666 VSDLIEEFAAMANA-----------------------------------------AGVKL 17158741 INDLIEEFSALAAA-----------------------------------------ASLQL 16331909 VEDLTEEFASLAIA-----------------------------------------AGVLL 22002503 LLDVVEEQSLYAQE-----------------------------------------QNLSL 16331561 LIEVIEEQRLTAEQ-----------------------------------------RGIFL 15900028 LIECMSEFQFLIEQ-----------------------------------------ERRDV 16125984 ------------------------------------------------------------ 16120376 ------------------------------------------------------------ 21398527 LEEIVEPYKEIASY--Q-------------------------------------EKEMIL 23124069 IDSTLLILQNRLKAKPE-------------------------------------HPKIEI 23129374 IDSTLMILQNRLKAKHD-------------------------------------HPGIEI 23126640 IESTLLILQHRLKDKPD-------------------------------------RPAIEV 17228138 IESTLLILQHRLKDQPD-------------------------------------KPAIEV 23130517 IDSTLMILQHRLKAKPE-------------------------------------QPEIEV 17229043 IDNTLLILQHRLKEKPE-------------------------------------HQEIKV 17229973 IDSTLMILQHRLKEQPE-------------------------------------RPAVQV 23130568 IDSTMMILQHRLKAKSD-------------------------------------RVGIEL 23124579 IDNTLLILEHRLKAKSN-------------------------------------SLTIDI 23129091 IDSTLMILQNRLKPSGD-------------------------------------SLTIHV 17230717 IDSTLMILQNRLKAKSD-------------------------------------HPEILV 23129381 LDSTLLILQHRLKANSL-------------------------------------HLGIEI 23124797 IDNTLLILQHQLKGNGK-------------------------------------FPGIQV 23125086 IDSTLLILQHRLKAQNN-------------------------------------RPQIQV 23125525 IDGTLMILHHRLKAAIR-------------------------------------RPKIEI 17232208 IDNTILLLKNRLKGQGK-------------------------------------HPDIEV 23126381 IDNSLMILQHRLKENSN-------------------------------------FPEIEV 17232179 IDNTLMILHHRLKENSE-------------------------------------RPAITL 23130314 IDSTLLILQHRLQPETN-------------------------------------SFAIEV 17231753 IDSTLLILQHRLQANTN-------------------------------------IVEIEV 23128669 LDSTLLILGHRLKNNNE-------------------------------------RPAIEI 23124502 INSTLMILQNRLKPQPD-------------------------------------SPGIQV 17228204 IDSTILILKHRLKANDQ-------------------------------------RPAIDV 17228205 IDSTILILKHRLKANQQ-------------------------------------HPAIEV 17231049 IDSSILILKHRLKANEQ-------------------------------------RPAIEV 17231183 IDSTILILKHRLKANDK-------------------------------------RPAIEV 17227850 IDSTILILKHRLKANEQ-------------------------------------RPAIEV 17228395 IESTLLILRHRLKANQY-------------------------------------RPAIEV 23129758 IDSTILILRHRLKANEN-------------------------------------RPAIEV 23123961 IDSTLLILHHRLEEKAH-------------------------------------RPGIDV 23054214 LDSTINIVWNELKYKAT------------------------------------------L 15615279 ------------------------------------------------------------ 1084017 VSFAVKLARAEVRERAR------------------------------------------- 23020725 KNNMNLFISKKIELEMG-------------------------------------NLDFNI 23023165 ------------------------------------------------------------ 15644413 ------------------------------------------------------------ 16126012 --------------TLK-------------------------------------QGIH-- 22957099 LARFLADLRLMAGPTLP-------------------------------------EGVALE 23106942 VAATRTCIDDFHRVIED-------------------------------------DGGQII 15887876 LKRIETDFAPMAQE-----------------------------------------KNLDL 22955591 ------------------------------------------------------------ 22960563 LCAAIEGAEGGRAR-----------------------------------------IEAEL 21302079 VRDAYENARFLCDQYYL--------------------------------------ASPEL 17137298 VRDAYENARFLCDQYYL--------------------------------------TSPAL 3183111 VHDAYENARFLCERYYL--------------------------------------TAPGM 17556919 VYDAFENARFLCDRYYL--------------------------------------TSPSM 19526816 VKDAYDMAKLLCDKYYM--------------------------------------ASPDL 13540705 VKDAYDMAKLLCDKYYM--------------------------------------ASPDL 19923736 VKDAYDMAKLLCDKYYM--------------------------------------ASPDL 8895958 VKDAYDMAKLLCDKYYM--------------------------------------ASPDL 20071134 IKDGYENARRLCDLYYV--------------------------------------NSPEL 12837543 IKDGYENARRLCDLYYV--------------------------------------NSPEL 16758676 IKDGYENARRLCDLYYV--------------------------------------NSPEL 4505689 IKDGYENARRLCDLYYI--------------------------------------NSPEL 4885545 VKDAYETAKMLCEQYYL--------------------------------------VAPEL 20348831 VKDAYETAKMLCEQYYL--------------------------------------VAPEL 7305375 VQDAFECAKMLCDQYYL--------------------------------------TSPEL 16758318 VEDAFECAKMLCDQYYL--------------------------------------TSPEL 4505693 VQDAFECSRMLCDQYYL--------------------------------------SSPEL 12585306 IQDAFESSKMLCDQYYL--------------------------------------TSPEL 11260590 ARNASEDARSICFREYG--------------------------------------SAP-- 6437541 ARNASEDARSICFREYG--------------------------------------SAP-- 12039359 AQHATEDARAICMREYG--------------------------------------SAP-- 3746431 ARIASEDARAICMREYG--------------------------------------SSP-- 12829952 AQAASEDARSICLREYG--------------------------------------SAP-- 13249142 GQAASEDARSICLREYG--------------------------------------STSSW 3695005 AQAACEDARSVCLREYG--------------------------------------SAP-- 18376030 AQEAIENARFVCEDHYG--------------------------------------LFEAP 19114791 IEGAAENAKYICRLAYG--------------------------------------LFEAP 11432626 IEKWVDFARRLCEHKYG--------------------------------------NAPRV 14602703 IEKWVDFARRLCEHKYG--------------------------------------NAPRV 15451424 IEKWVDFARRLCEHKYG--------------------------------------NAPRV 16975323 IEKWVDFARRLCEHKYG--------------------------------------NAPRV 252737 IEKWVDFARRLCEHKYG--------------------------------------NAPRV 13278573 IEKWVDFARRLCEHKYG--------------------------------------NAPRV 20843792 IEKWVDFARRLCEHKYG--------------------------------------NAPRV 22086550 KANGTLTLQDSGLGMTK-------------TDLVNNLG-------------TIAKSGTKA 1708316 KTAKTLTLIDSGIGMTK-------------TDMVKNLG-------------TIARSGTKN 13812107 KNNKSLTLIDTGIGMTK-------------DDLIQNLG-------------TIAKSGTKS 168256 KENKTLTIRDTGIGMTK-------------ADLVNNLG-------------TIARSGTKQ 16130581 KENKTLTIRDTGIGMTK-------------ADLVNNLG-------------TIARSGTKQ 6016265 KENKTLTIQDTGIGMTK-------------ADLVNNLG-------------TIARSGTKQ 12718221 KANKTLTIRDTGIGMTK-------------ADLVNNLG-------------TIARSGTKQ 6979704 KANKTLTIRDTGIGMTK-------------ADLVNNLG-------------TIARSGTKQ 15554354 -----------GIGMTK-------------ADLINNLG-------------TIARSGTKQ 1170381 KDQKVLEIRDSGIGMTK-------------ADLVNNLG-------------TIAKSGTKS 7549229 KDQKVLEIRDSGIGMTK-------------ADLVNNLG-------------TIAKSGTKS 3401959 PEQKVLEIRDSGIGMTK-------------AELINNLG-------------TIAKSGTKA 6325016 PEQKVLEIRDSGIGMTK-------------AELINNLG-------------TIAKSGTKA 171723 PEEKVLEIRDSGIGMTK-------------AELINNLG-------------TIAKSGTKA 1076876 KENKILTIRDTGIGMTK-------------NDLINNLG-------------VIAKSGTKQ 19115277 KENKILSIRDTGIGMTK-------------NDLINNLG-------------VIAKSGTKQ 9082289 --------------MTK-------------ADLINNLG-------------TIAKSGTKA 123681 PQERTLTLVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 2194027 PQERTLTLVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 11277141 PQERTLTLVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 20177936 PQERTLTLVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 194027 PQERTLTLVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 1346320 PQEATLTLVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 72222 PQERTLTLVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 722220 PQERTLTLVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 6680305 PQERTLTLVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 2351110 PQERTLTLVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 417155 PRDPTLTLLDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 1093929 KQDQTLTIVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 22065017 KQDQTLTIVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 18605741 --------------MTK-------------ADLINNLG-------------TIAKSGTKA 20882565 --------------MTK-------------ADLINNLG-------------TIAKSGTKA 16123678 KQDRTLTIVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 6016267 KQDRTLTIVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 13129150 KQDRTLTIVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 1732486 KQDRTLTIVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 17865490 KQDRTLTIVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 14270366 KQDRTLTIVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 194033 KQDRTLTIVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 1170383 KQDRTLTIVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 18996805 KHDRTLTIVDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 295722 KHD--------------------------------------------------------- 722210 KHDRTLTIVDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 123668 KHDRTLTIVDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 16123668 KHDRTLTIVDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 18858873 QKERTLTIIDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 632026 QKERTLTIIDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 1899173 LRTRTLTLVDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 18858875 VQERTLTLIDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 632027 VQERTLTLIDTGIGMTK-------------ADLMNNLG-------------TIAKSGTKA 4835864 VEERTLTLIDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 1150850 RQERTLTVIDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 14041148 KDDNTLTIIDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 15628191 VHERTLTLIDTGIGMTK-------------ADLINNLG-------------TIAKSGTKA 20985727 -------------------------------DLINNLG-------------TIAKSGTKA 17647529 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 16123663 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 123663 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 6016262 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 123664 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 16123664 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352553 KTAGTLTIIDTGIXMTK-------------SDLVNNLG-------------TIAKSGTKA 2352581 KTAGTLTIIDTXIXMTK-------------SDLVNNLG-------------TIAKSGTKA 2352579 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2984410 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352567 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352615 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 123662 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 1236625 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352599 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352601 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352607 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352617 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352597 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352591 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352603 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352605 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352609 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352611 KTAGTLTIIDTGIXMTK-------------SDLVNNLG-------------TIAKSGTKA 2352555 KTAGTLTIIDTGIXMTK-------------SDLVNNLG-------------TIAKSGTKA 2352563 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352565 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352573 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352595 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352559 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352571 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352593 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352585 KTAGTLTIIDTGIXMTK-------------XDXVNNXG-------------TXAKSGTKA 2352587 KTAGTLTIIDTGIXMTK-------------SDLVNNLG-------------TIAKSGTKA 2352583 KTAGTLTVIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 2352589 KTAGTLTIIDTGIXMTX-------------SDLVNXLG-------------TIAKSGTKA 2352575 KTAGTLTIIDTGIXMTK-------------SDLVNNLG-------------TIAKSGTKA 2352619 KTAGTLTIIDTGIGMTK-------------SDLVNNLG-------------TIAKSGTKA 29027546 KADKTLTIMDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 19855062 KADKTLTIMDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 11640609 ---------DTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 17559162 KEEKTLTIMDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 2826164 KEAGTLTVLDTGIGMTK-------------ADLINNLG-------------TIASSGTKA 6018206 KANNSLTIIDTGIGMTK-------------ADLVNNLG-------------TIARSGTRA 8272598 KADNTLTMIDTGIGMTK-------------ADLVNNLG-------------TIARSGTRA 8272594 KASNSLTIMDTGIGMTK-------------ADLVNNLG-------------TIARSGTRA 8272596 KASNSLTIMDTGIGMTK-------------ADLVNNLG-------------TIARSGTRA 6018207 KASNSLTMIDTGIGMTK-------------ADLVNNLG-------------TIARSGTRA 6018209 ------------------------------------------------------------ 6018208 KASNTLTIIDTGIGMTK-------------ADLVNNLG-------------TIARSGTRA 8272604 ------------------------------------------------------------ 8272606 KASNTLTIIDTGIGMTK-------------ADLVNNLG-------------TIARSGTRA 8272602 KASNTLTIIDTGIGMTK-------------ADLVNNLG-------------TIARSGTRA 1066807 KEAGTLTLIDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 21292624 KEAGTLTLIDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 7739799 ------------------------------------------------------------ 13699184 KNEGTLTIIDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 12005809 KSEGTLTIIDTGIGMTK-------------ADLVNNLG-------------TIAKSGTKA 6018212 KATNTLTLIDTGIGMTK-------------ADLVNNLG-------------TIARSGTKA 8272590 ------------------------------------------------------------ 6018213 KTNNTLTLIDTGIGMTK-------------ADLVNNLG-------------TIARSGTKA 6018215 KNSNTLTFIDTGIGMTK-------------ADLVNNLG-------------TIARSGTKA 6018211 KNSNTLTIIDTGIGMTK-------------ADLVNNLG-------------TIARSGTKA 6018210 KDNKVLHIIDTGVGMTK-------------ADMVNNLG-------------TIARSGTRA 14486722 KDNKILQVIDTGVGMTK-------------ADMVNNLG-------------TIARSGTRA 14486724 KDNKLLHVVDTGVGMTK-------------ADMVNNLG-------------TIARSGTRA 6018214 KQDQTLTIIDTGIGMTK-------------SGLINNLG-------------TIAKSGTRA 1515105 KPNKTLSIIDSGIGMTK-------------ADLVNNLG-------------TIARSGTKE 1708312 KANKTLSIIDSGIGMTK-------------ADLVNNLG-------------TIARSGTKE 15237214 KSNKTLSIIDSGIGMTK-------------ADLVNNLG-------------TIARSGTKE 217855 KSNKTLSIIDSGIGMTK-------------ADLVNNLG-------------TIARSGTKE 1708314 KTNKTLSIIDSGVGMAK-------------ADLVNNLG-------------TIARSGTKE 6729771 KASKTLSIIDSGVGMTK-------------SDLVNNLG-------------TIARSGTKE 729771 KASKTLSIIDSGVGMTK-------------SDLVNNLG-------------TIARSGTKE 477226 KASKTLSIIDSGVGMTK-------------SDLVNNLG-------------TIARSGTKE 15215642 KTNNTLTIIDSGIGMTK-------------ADLVNNLG-------------TIARSGTKE 1906826 KTNNTLTIIDSGIGMTK-------------ADLVKNLG-------------TIARSGTKE 1708313 KTNNTLTIIDSGIGMTK-------------ADLVNNLG-------------TIARSGTKE 15241115 KTNNTLTIIDSGIGMTK-------------ADLVNNLG-------------TIARSGTKE 20502888 KTNNTLTIIDSGIGMTK-------------ADLVNNLG-------------TIARSGTKE 547683 KANNTLTIIDSGIGMTK-------------ADLVNNLG-------------TIARSGTKE 17547683 KANNTLTIIDSGIGMTK-------------ADLVNNLG-------------TIARSGTKE 7417154 KASNTLSIIDSGIGMTK-------------SDLVNNLG-------------TIARSGTKE 417154 KASNTLSIIDSGIGMTK-------------SDLVNNLG-------------TIARSGTKE 5123910 KATSTLTIVDSGIGMTK-------------SDLVNNLG-------------TIARSGTKE 4204859 KATNTLTLIDSGIGMTK-------------SDLVNNLA-------------TIGRSGTKD 4204861 ------------------------------------------------------------ 2982291 KTNNSLTIIDSGIGMTK-------------SDLVNNLG-------------TIARSGTKE 625986 ------------------------------------------------------------ 123676 KNNNTLTIEDSGIGMTK-------------ADLVNNLG-------------TIAKSGTRA 16123676 KNNNTLTIEDSGIGMTK-------------ADLVNNLG-------------TIAKSGTRA 7381186 KTNKTLTIEDTGIGMTK-------------TDLINNLG-------------TIAKSGTKA 19908703 KTNNTLTIEDSGIGMTK-------------NELINNLG-------------TIAKSGTKA 11277136 KTNNTLTIEDSGIGMTK-------------NDLINNLG-------------TIARSGTKA 6016264 KANNTLTIENSGIGMTK-------------ADLVNNLG-------------TIARSGTKA 9837420 KNNNTLTIQDTGIGMTR-------------DEMINNLG-------------TIAKSGTKA 9837422 KNNNTLTIQDTGIGMTR-------------DEMINNLG-------------TIAKSGTKA 9837418 KNDNTLTLWDTGIGMTK-------------KELINNLG-------------TIAKSGTKA 5257484 KANNTLTLWDTGIGMTK-------------KELINNLG-------------TIAKSGTKA 123665 KENKTLTVEDNGIGMTK-------------ADLVNNLG-------------TIARSGTKA 16123665 KENKTLTVEDNGIGMTK-------------ADLVNNLG-------------TIARSGTKA 1362545 KENKTLTVEDNGIGMTK-------------ADLVNNLG-------------TIARSGTKA 21542414 KENKTLTVEDNGIGMTK-------------ADLVNNLG-------------TIARSGTKA 1168148 KANKTLTVEDNGIGMTK-------------ADLVNNLG-------------TIARSGTKA 320900 RVNKTLTVEDSGIGMTK-------------ADLVNNLG-------------TIARSGTKS 1236665 RVNKTLTVEDSGIGMTK-------------ADLVNNLG-------------TIARSGTKS 84062 KANKTLTVEDTGIGMTK-------------AELVNNLG-------------TIARSGTKA 16123667 KANKTLTVEDTGIGMTK-------------AELVNNLG-------------TIARSGTKA 2735814 RVNKTLTVRTVASVMTK-------------ADLVNNLG-------------TIARSGTKS 20830045 KQDQTLPIVDTGTGMTK-------------ADLINKLD-------------TISRSGTKA 22041160 TQEHTLTLVDTGIGMTK-------------ADLINNLG-------------TIAK----- 20881809 PQEHTMTLDD-------------------------------------------------- 21239744 KASNTLSIIDSGIGMTK-------------SDLVNNLG-------------TIARSGTKE 20878352 AQKHMLTLIDTAIGMTK-------------ADLIQNLG-------------TISISSTKA 21289472 KEGKVLHIIDTGIGMTK-------------QDLVNNLG-------------TIAKSGTAD 21357739 KENKALHIMDSGIGMTH-------------QDLINNLG-------------TIAKSGTAD 729425 KEKNLLHVTDTGVGMTR-------------EELVKNLG-------------TIAKSGTSE 7294254 KEKNLLHVTDTGVGMTR-------------EELVKNLG-------------TIAKSGTSE 16041057 KEKNLLHVTDTGVGMTR-------------EELVKNLG-------------TIAKSGTSE 17865698 KEKNLLHVTDTGVGMTR-------------EELVKNLG-------------TIAKSGTSE 14327942 KEKNLLHVTDTGVGMTR-------------EELVKNLG-------------TIAKSGTSE 14714615 KEKNLLHVTDTGVGMTR-------------EELVKNLG-------------TIAKSGTSE 6015101 KEKNLLHVTDTGVGMTR-------------EELVKNLG-------------TIAKSGTSE 2267127 KEKNMLHVTDTGIGMTK-------------EELIKNLG-------------TIAKSGTSE 63509 KEKNMLHVTDTGIGMTK-------------EELIKNLG-------------TIAKSGTSE 2119732 KEKNMLHVTDTGIGMTK-------------EELIKNLG-------------TIAKSGTSE 119359 KEKNMLHVTDTGIGMTK-------------EELIKNLG-------------TIAKSGTSE 14579649 KEKNMLHVTDTGIGMTK-------------EELIKNLG-------------TIAKSGTSE 17542208 RENRLLHITDTGVGMTR-------------QDLINNLG-------------TIARSGTSE 10644561 ------------------------------------------------------------ 7673568 KDARTLHIIDTGIGMTE-------------AELTSNLG-------------TIAKSGTSE 5442420 KENKILSIRDRGVGMTK-------------EDLIKNLG-------------TIAKSGTSA 544242 KENKILSIRDRGVGMTK-------------EDLIKNLG-------------TIAKSGTSA 18855040 KEKKILSIRDRGIGMTK-------------EDLIKNLG-------------TIAKSGTSA 462013 KEKKILSIRDRGIGMTK-------------EDLIKNLG-------------TIAKSGTSA 15233740 KAKKILSIRDRGIGMTK-------------EDLIKNLG-------------TIAKSGTSA 11277137 KANNVLHITDRGVGMTK-------------DELVRNLG-------------TIAQSGTKE 15228059 PDNGTITITDTGIGMTK-------------EELIDCLG-------------TIAQSGTSK 1906830 PDNGTITITDTGIGMTK-------------EELIDCLG-------------TIAQSGTSK 15628189 PDAGTITITDSGIGMTK-------------DELKDCLG-------------TIAQSGTSK 1076758 PDAGTITITDSGIGMTK-------------DELKDCLG-------------TIAQSGTSK 15231505 KENGIITLTDSGIGMTR-------------QELVDCLG-------------TIAQSGTAK 3273568 NDKRTITISDTGIGMTR-------------HDLVTNLG-------------TVAKSGTAN 19880568 KEKSELILRDGGVGMTK-------------EELAKHLG-------------SLGTSGTKH 7689258 KEKSELILRDGGVGMTK-------------EELAKHLG-------------SLGTSGTKH 1708336 SEKGTLTVSDNGIGMTR-------------EQVIDHLG-------------TIAKSGTKE 16272078 ADKGTITISDNGIGMTR-------------EQVIDHLG-------------TIAKSGTKE 15602889 EEKGTLTISDNGIGMTR-------------DEVIDHLG-------------TIAKSGTKE 16759466 KDKRTLTIADNGVGMNR-------------DEVIDHLG-------------TIAKSGTKS 17865481 KDKRTLTIADNGVGMNR-------------DEVIDHLG-------------TIAKSGTKS 16763867 KDKRTLTIADNGVGMNR-------------DEVIDHLG-------------TIAKSGTKS 15800202 KDKRTLTISDNGVGMTR-------------DEVIDHLG-------------TIAKSGTKS 16123284 KEKRTLTLSDNGIGMTR-------------DEVIDNLG-------------TIAKSGTKA 15641000 KDKNTLTISDNGIGMTR-------------DEVIENLG-------------TIAKSGTAE 5825486 ------------------------------------------------------------ 1708338 EAANTLTISDNGIGMSR-------------EDVIEHLG-------------TIAKSGTAD 15596793 KEANTVTLEDNGIGMSR-------------EDVVTHLG-------------TIAKSGTAD 23060493 KDAKTVTLEDNGIGMNR-------------DDVITHLG-------------TIAKSGTAD 23102358 KEARTVTLEDNGIGMSR-------------EDAILHLG-------------TIAKSGTAD 21243261 KDARTVTIDDNGIGMSR-------------EDAVSHLG-------------TIAKSGTAD 21231830 KEARTVTIDDNGIGMSR-------------EDAVSHLG-------------TIAKSGTAD 22995135 KQAHTITIDDNGIGMSR-------------YEAIAHLG-------------TIAKSGTAD 22997683 KQAHTITIDDNGIGMSR-------------DEAIAHLG-------------TIAKSGTAD 15837580 KQAHTITIDDNGIGMSR-------------DEAIAHLG-------------TIAKSGTAD 23026686 KEAKTLSITDNGIGMNR-------------DEVIANLG-------------TIARSGTAQ 22976164 PAARTLKITDNGIGMSR-------------DEAIRNLG-------------TIARSGTKE 17545709 AQARTVTIADNGIGMSR-------------DEAIRNLG-------------TIARSGTRE 22985781 KDARTITIDDNGIGMSR-------------DEAIANLG-------------TIARSGTKE 22955614 KEARTITIIDNGIGMSR-------------QEVINNIG-------------TIAKSGTRE 23001902 KEAGTFSIMDNGIGMSR-------------DEVISNIG-------------TIAKSGTKE 15617081 KAQRTLIISDNGIGMTK-------------EDTIENLG-------------TIAKSGTKS 21672733 KSQGTLIISDNGIGMTR-------------QDVVENLG-------------TIAKSGTKS 23015985 KDAGTLTIVDNGLGMSH-------------DELIANLG-------------TIAKSGTSE 22965455 AEAGTLTIADNGIGMNR-------------HELIENLG-------------TIARSGTQA 15893225 KDHRQIIIRDNGIGMNK-------------DDLIENLG-------------TIARSGTAN 15604670 KDNGQIIIRDNGIGMNK-------------EDLIENLG-------------TIARSGTAN 23053556 KEAGTITIRDNGVGMTM-------------EEVEKNIG-------------TIAHSGTKA 15613570 KEDRTLTVSDTGIGMTK-------------EELESNLG-------------TIAKSGSLA 16081033 KDARTLTISDTGIGMTK-------------DELEQHLG-------------TIAKSGSLA 18309398 KEERTLTISDKGIGMTE-------------KELDENLG-------------VIAKSGSLQ 15896558 KENKTLTITDTGIGMTK-------------DDLENNLG-------------TIAKSGSFA 23100613 KEERTLTVVDTGIGMTK-------------EELENNLG-------------VIAKSGSHT 19703666 KDNRTLTISDNGIGMTY-------------EEVDDNIG-------------TIAKSGSKL 15594905 D--KSILIKDNGIGMDE-------------QDLTNHLG-------------VIAKSGTKE 15791880 KDKKTLSISDNGIGMDK-------------DDLINNLG-------------TIAKSGTKS 15611266 SQKKTLTIKDNGIGMDK-------------SDLIEHLG-------------TIAKSGTKS 15644838 SQKKTLTIKDNGIGMDK-------------NDLIEHLG-------------TIAKSGTKN 15639968 EDAQRLVVRDTGIGMNA-------------EDLRANLG-------------TIARSGTKA 22961977 KAPDTLTIVDNGIGMDR-------------QELIDNLG-------------TIAKSGTKS 15827855 KNTRILTVRDNGIGMTR-------------AEVVDLIG-------------TLAKSGTAK 15609436 KAARTLTVRDNGIGMAR-------------EEVVDLIG-------------TLAKSGTAE 21225782 KDARTLTVRDNGIGMSY-------------DEVTRLIG-------------TIANSGTAK 21294891 KQDRQLTIQDTGIGMTR-------------DELVANLG-------------TIARSGSKQ 17137688 KPLMQLIIQDTGIGMTK-------------EELVSNLG-------------TIARSGSKK 1082886 AEKGTITIQDTGIGMTQ-------------EELVSNLG-------------TIARSGSKA 21752190 AEKGTITIQDTGIGMTQ-------------EELVSNLG-------------TIARSGSKA 13385998 AKKGTITIQDTGIGMTQ-------------EELVSNLG-------------TIARSGSKA 13905144 AKKGTITIQDTGIGMTQ-------------EELVSNLG-------------TIARSGSKA 17402847 KDKRTITFEDTGIGMNR-------------EDLVKFLG-------------TIAKSGSKD 21673658 KESGSFVIEDTGIGMSE-------------EELISNLG-------------TVASSGTLG 23112245 ENAKTLTIADAGIGMTK-------------EDLIENIG-------------TIAHSGSKA 22974366 KEARTLSISDTGIGMTA-------------DEMVEHLG-------------TIAQSAARA 13471897 PDNKEITVEDNGIGMSR-------------DDMAEALG-------------TIARSGTRA 16264597 EENARLVIEDNGIGMGR-------------DELVESLG-------------TIARSGTRA 19074029 KDNRTLTIKDNGIGMTK-------------PDLMNFIG-------------TIASSGTKK 22970048 KEARTLSISDTG------------------------------------------------ 17865477 --KDTITISDRGIGLTA-------------EEIDKYIN-------------QIAFSGAND 17865496 EVARTITVSDRGVGMTE-------------EEVEKYIN-------------QIAFSSAEE 23136628 KEAGTITITDRGIGMTA-------------EEIKKYIN-------------QIAFSGATE 16332281 KVNKTLSITDNGIGMTA-------------DEVKKYIN-------------QVAFSSAEE 23042149 KDNQSISITDNGIGMTT-------------DEIKKYIN-------------QVAFSSAEE 22298734 KENKKLAIADNGIGMTA-------------EEVKKYIT-------------QVAFSSAEE 6136879 RDRKQLKIADNGIGMTA-------------DEIKRYIN-------------QVAFSSAED 23122748 REKNILKISDNGIGMND-------------EEIKKYIN-------------QVAFSSAEE 17451483 KQNQTLTIVDTRIGMTK-------------TDLINNLG-------------TVTKSGTKA 22041746 KQDRTLTIVDTGIGMTK-------------ADLINNLG-------------TITKSETKV 20827505 PQVATLTLVNTGIGMTK-------------TDLINNLR-------------TIAKSGTKA 20848817 PQEHTLTLVDIGIGMTK-------------ADLINNLG-------------TIAKSGTKA 20862694 KQHQTLIIVDTGIGMAK-------------VGLINNLG-------------TIAKSGTKV 20855641 SQEHTLTLVRH-TDMTP-------------R--VTSLG-------------AINKTSTKG 20879409 --------------MIV-------------ADLIHNLE-------------IIVKSGTKA 5817861 LKGEVIRVTDNGRGIPV-------------DIHPKTKR-----------------PAVET 19705416 LPENIIEVMDNGRGIPT-------------DIHPKYGK-----------------SAMEI 21397975 EEDNSIRVTDNGRGIPV-------------GIQEKMGR-----------------PAVEV 15612569 EEDNSITVTDNGRGIPV-------------GIHEKMGR-----------------PAVEV 16077074 EKDNSITVVDNGRGIPV-------------GIHEKMGR-----------------PAVEV 23097461 EEDNSITVKDNGRGIPV-------------DIQQKTGR-----------------PALEV 15982567 EPDDSITVIDDGRGIPV-------------GIQAKTGR-----------------PAVET 22991526 EKDNSITVIDDGRGIPV-------------DIQAKTGR-----------------PAVET 15674782 EADNSITVVDDGRGIPV-------------DIQAKTGR-----------------PAVET 19745824 EADNSITVVDDGRGIPV-------------DIQAKTGR-----------------PAVET 21910012 EADNSITVVDDGRGIPV-------------DIQVKTGR-----------------PAVET 22536796 EPDNSITVVDDGRGIPV-------------DIQEKTGR-----------------PAVET 1052804 EPDDSITVVDDGRGIPV-------------GIQEKTGR-----------------PAVET 15900699 EPDDSITVVDDGRGIPV-------------DIQEKTGR-----------------PAVET 1490397 EPDDSITVVDDGRGIPV-------------DIQEKTGR-----------------PAVET 15672887 EPDNSITVVDDGRGIPV-------------DIQEKTGR-----------------PAVET 16799085 EADNSITVRDNGRGIPT-------------GINEKIGR-----------------PTVEV 16802054 EADNSITVRDNGRGIPT-------------GINEKIGR-----------------PTVEV 153085 EKDNWIKVTDNGRGIPV-------------DIQEKMGR-----------------PAVEV 15922995 EKDNWIKVTDNGRGIPV-------------DIQEKMGR-----------------PAVEV 23024059 EKDNSITVTDDGRGIPV-------------DIQTKTGK-----------------PALET 23036988 EKDNSITITDDGRGVPV-------------EIQPKTGR-----------------PAMEA 23003074 NEDGSVTVQDDGRGIPV-------------DIQAKTGR-----------------PALET 462227 NKDESITVIDNGRGIPI-------------EIHPKTKV-----------------STLET 16078870 HKDNSISVQDRGRGMPT-------------GM---LGK-----------------PTPEV 3914289 HKDNSISVQDRGRGMPT-------------GMHK-LGK-----------------PTPEV 21401521 HKDNSISVIDKGRGMPT-------------GMHK-LGK-----------------PTPEV 15614703 HKDQSVSVRDEGRGMPT-------------GMHK-LGK-----------------PTPEV 23099148 HKDESVSVKDSGRGMPT-------------GMHQ-TGK-----------------PTTEV 15924344 NKDGSISIEDNGRGMPT-------------GIHK-SGK-----------------PTVEV 1709584 NKDGSISIEDNGRGMPT-------------GIHK-SGK-----------------PTVEV 15982570 QKDNSICVADSGRGMPT-------------GMHA-SGI-----------------PTVEV 16800393 HDDGSVSVSDEGRGMPV-------------GMHK-TGK-----------------STVEV 16803326 HEDGSVSVSDEGRGMPV-------------GMHK-TGK-----------------STVEV 15900737 NKDGSLTVQDHGRGMPT-------------GMHA-MGI-----------------PTVEV 15902800 NKDGSLTVQDHGRGMPT-------------GMHA-MGI-----------------PTVEV 15672961 NADGSLSVEDEGRGMPV-------------GKHA-MGI-----------------PTVEV 15186713 NKDGSITVTDHGRGMPT-------------GMHA-MGK-----------------PTVEV 22537312 NKDGSITVTDHGRGMPT-------------GMHA-MGK-----------------PTVEV 15674930 NKDGSVSVADSGRGMPT-------------GQHA-MGI-----------------PTVQV 23023557 HDN--ITVQDFGRGMPI-------------GMHE-SGK-----------------PTPEV 23037924 HQDNSITVVDHGRGMPV-------------GMHA-SGK-----------------PTPEV 23002511 HKDNSITVQDFGRGMPT-------------GMHA-SGI-----------------PTIEV 21708093 EKDNSITVIDNGRGIPT-------------GMHK-TGK-----------------PTPEV 938029 EKDNSITVIDNGRGIPT-------------GMHK-TGK-----------------PTPEV 1708093 EKDNSITVIDNGRGIPT-------------GMHK-TGK-----------------PTPEV 7387745 HPNNEIEVIDNGRGMPV-------------DIHPTTKK-----------------SAVET 1170146 YPNNVIEVEDNGRGMPT-------------GIHSGTKK-----------------SAVET 15829210 DNDNLITIEDDGRGIPV-------------DRHPETGI-----------------STVET 13507742 KDNFVTIVEDDGRGIPV-------------DIHPKTNR-----------------STVET 22127614 KDNFVTIVEDDGRGIPV-------------DIHPKTNR-----------------STVET 2127614 KDNFVTIVEDDGRGIPV-------------DIHPKTNR-----------------STVET 12044853 EDNFVTRVEDDGRGIPV-------------DIHPKTNR-----------------STVET 1346241 KDNYLVEVEDDGRGIPV-------------DIHEKTNK-----------------STVET 13357637 KKDGSVRVEDDGRGIPI-------------EIHEKTGL-----------------SGVET 4099111 KKDDSVIVEDNGRGIPV-------------SKHGSGK------------------TGVEL 21903715 KKDSSVIVEDNGRGIPV-------------NKHESGK------------------SGVEL 15828843 TKNQSIRVEDNGRGIPV-------------EKHSSGK------------------SGVEL 529464 KKD-SIIVTDNGRGIPV-------------GKNLATNL-----------------STVDT 13358029 HEDNSISVLDDGRGIPV-------------DINSQTKI-----------------STVET 12045055 DLNNTITVSDDGRGIPY-------------EIHQDSNI-----------------STIDT 13507861 HAENQITVSDNGRGIPF-------------ETHSDSKI-----------------STIDT 15894905 NKDKSVTIIDNGRGIPT-------------GIHPIKKK-----------------SGVEM 18311051 NKDKSVTVIDNGRGIPT-------------GMHPIKKK-----------------TGVEM 21309845 KPDNVVSVSDNGRGIPV-------------DIHPKTKK-----------------SAVET 18414465 HADGSVSVVDNGRGIPT-------------DLHPATKK-----------------SSLET 9955568 HADGSVSVVDNGRGIPT-------------DLHPATKK-----------------SSLET 15228245 HSDDSVSISDNGRGIPT-------------DLHPATGK-----------------SSLET 6630698 HGDNSVSVTDNGRGIPT-------------DIHPQTKK-----------------SCVET 19909727 KADGSVSVTDDGRGIPT-------------DVHPTTGK-----------------SALET 19909729 KADGSVSVTDDGRGIPT-------------DVHPTTGK-----------------SALET 23128092 NADGSVTVTDDGRGIPV-------------DTHSRTGK-----------------SALET 17232757 NADGSVAVTDDGRGIPI-------------DTHSRTGK-----------------SALET 23043187 NKDGSVKVTDDGRGIPV-------------DTHSKTGK-----------------SALET 19909553 NADGSVTVTDDGRGIPT-------------GIHPKTGK-----------------SALET 16330312 NADGSVTVVDNGRGIPT-------------DIHPTTGR-----------------SALET 19909557 LKDGSCQVTDNGRGIPT-------------DIHPQTGK-----------------SALET 22298189 NAS--VTVTDDGRGIPT-------------DIHPDTGV-----------------SGVET 23130837 GPDGSASISDNGRGIPT-------------DVHSRTGK-----------------SALET 23132789 GEDGSASISDNGRGIPT-------------DVHPRTGK-----------------SALET 23123435 KEDGSALISDNGRGIPT-------------DIHPRTGK-----------------SALET 13812265 NSDKSVTIRDNGRGIPT-------------DLHPITNK-----------------TALET 6644316 ------------------------------------------------------------ 15530000 ------------------------------------------------------------ 6644317 ------------------------------------------------------------ 6644324 ------------------------------------------------------------ 6644322 ------------------------------------------------------------ 15530563 ------------------------------------------------------------ 6644326 ------------------------------------------------------------ 6644323 ------------------------------------------------------------ 3320890 ------------------------------------------------------------ 6644148 ----------------------------------------------------------EV AAN03628.1 ------------------------------------------------------------ 15551673 ------------------------------------------------------------ 2196850 ----------------------------------------------------------EV 2196852 ----------------------------------------------------------EV 2196854 ----------------------------------------------------------EV 15551715 ------------------------------------------------------------ 15551725 ------------------------------------------------------------ 22091020 ------------------------------------------------------------ 15551717 ------------------------------------------------------------ 7407142 ------------------------------------------------------------ 15551723 ------------------------------------------------------------ 22091034 ------------------------------------------------------------ 22091026 ------------------------------------------------------------ 22091032 ------------------------------------------------------------ 22090910 ------------------------------------------------------------ 22090932 ------------------------------------------------------------ 15551675 ------------------------------------------------------------ 22091036 ------------------------------------------------------------ 16762490 HADNSVSVTDDGRGIP-----------------TGIHPEEG----------V---SAAEV 1546916 HADNSVSVTDDGRGIP-----------------TGIHPEEG----------V---SAAEV 22090642 ------------------------------------------------------------ 22090904 ------------------------------------------------------------ 15804293 HADNSVSVQDDGRGIP-----------------TGIHPEEG----------V---SAAEV 7546302 HADNSVSVQDDGRGIP-----------------TGIHPEEG----------V---SAAEV 3212436 HADNSVSVQDDGRGIP-----------------TGIHPEEG----------V---SAAEV 15551701 ------------------------------------------------------------ 15551697 ------------------------------------------------------------ 15551685 ------------------------------------------------------------ 15551677 ------------------------------------------------------------ 19909647 ------------------------------------------------------------ 15551683 ------------------------------------------------------------ 15551693 ------------------------------------------------------------ 15551691 ------------------------------------------------------------ 15551681 ------------------------------------------------------------ 15551679 ------------------------------------------------------------ 15551695 ------------------------------------------------------------ 22091042 ------------------------------------------------------------ 22127978 HADNSVSVQDDGRGIP-----------------TGMHDEEG----------V---SAAEV 7107361 HADN-VSVQDDGRGIP-----------------TGMHDEEG----------V---SAAEV 15551719 ------------------------------------------------------------ 15551713 ------------------------------------------------------------ 15551711 ------------------------------------------------------------ 15551709 ------------------------------------------------------------ 15551705 ------------------------------------------------------------ 15551721 ------------------------------------------------------------ 2267054 ----------------------------------------------------------EV 15603341 HTDNSVSVQDDGRGIP-----------------VDIHPEEG----------V---SAAEV 15551707 ------------------------------------------------------------ 16272510 HDDNSVSVQDDGGGIP-----------------VDIHPEEG----------V---SAAEV 4894891 ------------------------------------------------------------ 4894893 ------------------------------------------------------------ 6018677 ------------------------------------------------------------ 6018679 ------------------------------------------------------------ 4894892 ------------------------------------------------------------ 6456476 ------------------------------------------------------------ 4894894 ------------------------------------------------------------ 2853305 ----------------------------------------------------------EV 6016182 ------------------------------------------------------------ 19909651 HEDNSVSVTDDGRGIP-----------------TEMHPEEN----------V---SAAEV 2853307 ------------------------------------------------------------ 2853310 ------------------------------------------------------------ 19909659 HDDNSVSVRDDGRGIP-----------------TEMHPEEQ----------V---SAAEV 15640047 HE--SVSVSDDGRGIP-----------------TEMHPEEK----------V---SAAEV 19909653 HEDNSVSVSDDGRGIP-----------------TELHEEE---------------NAAEV 19909655 HEDNSVSVSDDGRGIP-----------------TELHEEE---------------NVSEV 19909621 ------------------------------------------------------------ 19909623 ------------------------------------------------------------ 19909617 ------------------------------------------------------------ 9971293 ------------------------------------------------------------ 2267058 ------------------------------------------------------------ 2267076 ------------------------------------------------------------ 2267066 ------------------------------------------------------------ 2267072 ------------------------------------------------------------ 2267062 ------------------------------------------------------------ 2267068 ------------------------------------------------------------ 2267074 ------------------------------------------------------------ 2267078 ------------------------------------------------------------ 9802387 ------------------------------------------------------------ 2267060 ------------------------------------------------------------ 4835907 ------------------------------------------------------------ 2267080 ------------------------------------------------------------ 2267070 ------------------------------------------------------------ 2267064 ------------------------------------------------------------ 2353016 ----------------------------------------------------------EV 2905610 ----------------------------------------------------------EV 2353020 ----------------------------------------------------------EV 2353018 ----------------------------------------------------------EV 2196838 ----------------------------------------------------------EV 2353024 ----------------------------------------------------------EV 2905604 ------------------------------------------------------------ 2905606 ------------------------------------------------------------ 2196790 ------------------------------------------------------------ 2196812 ------------------------------------------------------------ 2196808 ----------------------------------------------------------EV 2196810 ----------------------------------------------------------EV 2905602 ----------------------------------------------------------EV 2905608 -----------------------------------------------------------I 4894896 ----------------------------------------------------------EV 2196846 ----------------------------------------------------------EV 18147145 ------------------------------------------------------------ 18147173 ------------------------------------------------------------ 18147183 ------------------------------------------------------------ 18147185 ------------------------------------------------------------ 18147179 ------------------------------------------------------------ 18147177 ------------------------------------------------------------ 18147151 ------------------------------------------------------------ 18147169 HPDESMSIQDNGRGIP-----------------TEMHEEEG----------V---SAAEV 18147181 HPDESMSIQDNGRGIP-----------------TEMHEEEG----------V---SAAEV 18147143 ------------------------------------------------------------ 18147175 ------------------------------------------------------------ 18147161 ------------------------------------------------------------ 18147163 ------------------------------------------------------------ 18147157 ------------------------------------------------------------ 18147171 ------------------------------------------------------------ 18147155 HPDESVSIQDNGRGIP-----------------VDIHEEEG----------V---SAAEV 18147153 ------------------------------------------------------------ 18147159 ------------------------------------------------------------ 18147167 ------------------------------------------------------------ 18147165 ------------------------------------------------------------ 18147141 ------------------------------------------------------------ 19909605 ------------------------------------------------------------ 19909599 HPDESITVSDNGRGIP-----------------TDVHEEEG----------A---A--EV 19909601 HPDESITVSDNGRGIP-----------------TDIHEEEG----------A---A--EV 18147147 ------------------------------------------------------------ 19909595 HADESVTVSDNGRGIP-----------------TELHEGEG----------V---S--AV 19909597 HPDESVTVSDNGRGIP-----------------TDIHEEEG----------V---S--AA 13359140 ------------------------------------------------------------ 18147149 HPDESVTVSDNGRGIP-----------------TDIHKEEG----------V---SAAEV 13359144 ------------------------------------------------------------ 19909619 ------------------------------------------------------------ 23027048 HPNESVTVSDNGRGIP------------------TEMHEEG----------V---SAAEV 22087113 ------------------------------------------------------------ 9971301 ----------------------------------------------------------EV 9971299 ------------------------------------------------------------ 9971295 ------------------------------------------------------------ 23104602 HTDESITVRDNGRGIP-----------------VDLHKEEG----------I---SAAEV 11078745 ------------------------------------------------------------ 11078719 ------------------------------------------------------------ 11078727 ------------------------------------------------------------ 11078897 ------------------------------------------------------------ 11078717 ------------------------------------------------------------ 11078715 ------------------------------------------------------------ 11078765 ------------------------------------------------------------ 11078723 ------------------------------------------------------------ 11078725 ------------------------------------------------------------ 11078751 ------------------------------------------------------------ 11078835 ------------------------------------------------------------ 15595202 HTDESITVRDNGRGIP-----------------VDIHKEEG----------V---SAAEV 6116692 HTDESITVRDNGRGIP-----------------VDIHKEEG----------V---SAAEV 23057577 HPDESITVKDNGRGIP-----------------VDVHKEEG----------V---SAAEV 19909707 HPDESITVKDNGRGIP-----------------VDVHKEEG----------V---SAAEV 19909645 ------------------------------------------------------------ 121893 HT-ESISVRDNGRGIP-----------------VDVHKEEG----------V---SAAEV 16121893 HTDESISVRDNGRGIP-----------------VDVHKEEG----------V---SAAEV 19909609 ------------------------------------------------------------ 19909615 ------------------------------------------------------------ 2267056 ----------------------------------------------------------EV 19909607 ------------------------------------------------------------ 9971297 ------------------------------------------------------------ 4996776 HGDGSVAVTDNGRGIP-----------------TEIMPEEG----------R---SAAEV BAA78433.1 HGDGSVAVTDNGRGIP-----------------TEIMPEEG---------------AAEV 19909611 ------------------------------------------------------------ 19909531 ------------------------------------------------------------ 19909671 HGDNSVTVTDNGRGIP-----------------VDIHTEEG----------R---SAAEV 13487309 ------------------------------------------------------------ 13487323 ------------------------------------------------------------ 19909723 HPDQSISIEDNGRGIPT-------------DIHPE----KG----------R---SAAEV 3550425 HPDNSVSISDNGRGIPT-------------DIKQDDIKAVK----------R---SAAEI 4996790 HADNSVSVTDNGRGIPT-------------DIHKD--DEFG----------R---SAAEI BAA78440.1 HADNSVSVTDNGRGIPT-------------DIHKD--DEF---------------SAAEI 4996818 HADNSVSVTDNGRGIPT-------------DIHKD--DEFG----------R---SAAEI BAA78454.1 HADNSVSVTDNGRGIPT-------------DIHKD--DEF---------------SAAEI 4996816 HSDSSISVTDNGRGIPT-------------AIHKD--DEFG----------R---SAAEI BAA78453.1 HSDSSISVTDNGRGIPT-------------AIHKD--DEF---------------SAAEI 4996832 HADNSISVTDNGRGIPT-------------AIHKD--DEHH----------R---SAAEI BAA78461.1 HADNSISVTDNGRGIPT-------------AIHKD--DEH---------------SAAEI 11270924 ------------------------------------------------------------ 22954054 HADNSVSIHDNGRGIPT-------------DIKQD--DELK----------R---SAAEI 11270928 ------------------------------------------------------------ 11270934 ------------------------------------------------------------ 11270926 ------------------------------------------------------------ 19909685 HADNSISVTDNGRGIPT-------------DVKMNDKHEPK----------R---SAAEI 22984295 HADNSISITDNGRGVPT-------------GLKMDDKHDPK----------R---SAAEI 19909711 HSDNSISIVDNGRGIPP-------------LVKFDDKHEPK----------R---SAAEI 19909715 HSDNSISIIDNGRGIPP-------------LVKFDDKHEPK----------R---SAAEI 19909713 HSDNSISIIDNGRGIPP-------------LVKFDDKHEPK----------R---SAAEI 19909709 HTDNSISIVDNGRGIPP-------------DVKFDDKHEPK----------R---SAAEI 17548157 HTDNSISVIDNGRGIPT-------------GIKFDDKHEPK----------R---SAAEI 19909661 ------------------------------------------------------------ 19909721 ----SISVTDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI 1944019 ------------------------------------------------------------ 4996804 HTDNSISVTDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAA78447.1 HTDNSISVTDNGRGIPT-------------GVKMDDKH--K----------R---SAAEI 4996796 HTDNSISVTDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAA78443.1 HTDNSISVTDNGRGIPT-------------GVKMDDKH--K----------R---SAAEI 4996788 HSDNSISVTDNGRGIPT-------------GVKMDDKHEPK----------R---SASEI BAA78439.1 HSDNSISVTDNGRGIPT-------------GVKMDDKH--K----------R---SASEI 4996798 HTDNSISVTDNGRGIPT-------------GVKMDDKHEPK----------R---SASEI BAA78444.1 HTDNSISVTDNGRGIPT-------------GVKMDDKH--K----------R---SASEI 4996834 HSDNSVSVTDNGRGIPT-------------GVKMDDKHEPK----------R---SASEI BAA78432.1 HSDNSVSVTDNGRGIPT-------------GVKMDDKHEP---------------SASEI BAA78462.1 HSDNSVSVTDNGRGIPT-------------GVKMDDKHKR---------------SASEI 19909657 ------------------------------------------------------------ 19909717 HSDNSISVTDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI 19909683 HTDNSISVTDNGRGIPT-------------GVKMDDKHEPK----------R---SASEI 4996784 HSDNSISVLDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAA78437.1 HSDNSISVLDNGRGIPT-------------GVKMDDKHEP---------------SAAEI 4996780 HADGSLSVTDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAA78435.1 HADGSLSVTDNGRGIPT-------------GVKMDDKHEP---------------SAAEI 4996786 HADGSLSVTDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAA78438.1 HADGSLSVTDNGRGIPT-------------GVKMDDKHEP---------------SAAEI 4996800 HADGSLSVTDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAA78445.1 HADGSLSVTDNGRGIPT-------------GVKMDDKHEPK---------------AAEI BAA78436.1 ------------------------------------------------------------ 4996826 HADGSLSVIDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAA78458.1 HADGSLSVIDNGRGIPT-------------GVKMDDKHEP---------------SAAEI 4996828 HADGSLSVIDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAA78450.1 HADGSLSVIDNGRGIPT-------------GVKMDDKHEP---------------SAAEI BAA78448.1 HADGSLSVIDNGRGIPT-------------GVKMDDKHEP---------------KAAEI 1944015 ------------------------------------------------------------ 1944017 ------------------------------------------------------------ 19909703 HADGSLSVIDNGRGIPT-------------RVKMDDKHEPK----------R---SAAEI 12060257 HADGSLSVIDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI 4996792 HADGSLSVIDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAA78441.1 HADGSLSVIDNGRGIPT-------------GVKMDDKHEP---------------SAAEI 4996808 HADGSLSVIDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAA78442.1 HADGSLSVIDNGRGIPT-------------GVKMDDKHEPK---------------AAEI 4996820 HADGSLSVIDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAA78455.1 HADGSLSVIDNGRGIPT-------------GVKMDDKHEP---------------SAAEI 4996812 HADGSLSVIDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAB87066.1 HADGSLSVIDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI BAA78451.1 HADGSLSVIDNGRGIPT-------------GVKMDDKHEP---------------SAAEI 4996824 HADGWLSVIDNGRGIPT-------------GVKMDDKHEPK----------R---SAAEI 1944013 ------------------------------------------------------------ 16272041 HA-HSVSVADNGRGMPT-------------GIHPKE----G----------R---SAAEV 121891 HA-HSVSVADNGRGMPT-------------GIHPKE----G----------R---SAAEV 482597 HADHSVSVADNGRGMPT-------------GIHPKE----G----------R---SAAEV 21218915 HADHSVSVADNGRGMPT-------------GIHPKE----G----------R---SAAEV 15676138 HADHSVSVADNGRGMPT-------------GIHPKE----G----------R---SAAEV 21672304 HSDNSVSIKDDGRGIPT-------------DIHPEE----K----------I---SAAEV 551761 HS-NSVSIKDDGRGIPT-------------DIHPEE----K----------I---SAA-- 15616640 HSDNSVSVKDDGRGIPT-------------DIHPEE----N----------I---SAAEV 121892 HSDNSVSVRDDGRGIPT-------------GIHEEE----G----------V---SAAEV 16121892 HSDNSVSVRDDGRGIPT-------------GIHEEE----G----------V---SAAEV 23000011 HTDGSCSVSDNGRGIPT-------------DMHKEE----G----------R---SAAEV 21240778 LADGSVAVSDNGRGVPV-------------DIHKEE----G----------V---SAAEV 21229482 HVDGSVAVSDNGRGVPV-------------DIHKEE----G----------V---SAAEV 22993815 HVDGSVSVSDNGRGIPV-------------DIHKEE----G----------V---SAAEV 22996622 HIDGSVSVSDNGRGIPV-------------DIHKEE----G----------V---SAAEV 15836610 HVDGSVSVSDNGRGIPV-------------DIHKEE----G----------V---SAAEV 18916405 NPDGSVTVTDNGRGIP-----------------TDIHTGEG---------------AAEV 15963765 NPDGSVTVTDNGRGIP-----------------TDIHREEG----------V---SAAEV 15887371 NADGSVTVTDNGRGIP-----------------TDIHSSEG----------V---SAAEV 17988106 NADGSCTVTDNGRGIP-----------------TDIHKEEG----------V---SAAEV 13474326 NPDGSVTVIDNGRGIP-----------------TDIHTGEG----------I---SAAEV 18916417 NADNSVTVYDDGRGIP-----------------VGIHKEEG----------V---SAAEV 18916420 NADNSVTVYDDGRGIP-----------------VGIHKEEG----------V---SAAEV 19979595 NADNSVTVRDDGRGIP-----------------VDIHKGEG---------------AAEV 19979609 NADNSVTVRDDGRGIP-----------------VDIHKGEG---------------AAEV 18916429 NADNSVTVRDDGRGIP-----------------VDIHKGEG----------I---SAAEV 19979613 NADNSVTVRDDGRGIP-----------------VDIHKGEG----------I---SAAEV 18916423 NADNSVTVRDDGRGIP-----------------VDIHKGEG----------I---SAAEV 18916432 NSDNSVTVRDDGRGIP-----------------VDIHKGEG----------I---SAAEV 18916435 NSDNSVTVRDDGRGIP-----------------VDIHKGEG----------I---SAAEV 18916441 NSDNSVTVRDDGRGIP-----------------VDIHKGEG----------I---SAAEV 19979597 NADNSVTVRDDGRGIP-----------------VDIHKGEG----------I---SAAEV 22962001 NADGSVTVRDDGRGIP-----------------VDIHKGEG----------V---SAAEV 18916411 NADGGVTVRDDGRGIP-----------------VDIHKGEG---------------AAEV 19909743 NPDGSVTVSDNGRGIP-----------------TDLHPEEG----------V---SAAEV BAB87067.1 NPDGSVTVSDNGRGIP-----------------TDLHPEEG----------V---SA--V BAB87068.1 NADGSVTVTDNGRGIP-----------------VDIHPEEG----------A-----AEV BAB87069.1 NADGSVTVTDNGRGIP-----------------VDIHPEEG----------I-----SAV 19909745 NADGSVTVTDNGRGIP-----------------VDIHPEEG----------I---SAAEV 22965523 NGDGSVTVCDNGRGIP-----------------VDIHREEG----------V---SAAEV 19909763 NADGSVTVEDNGRGIP-----------------TEIHPQEG---------------AAEV 19909543 NADGSVTVTDNGRGIP-----------------VDIHAEEG---------------AAEV 19909545 NADGSVTVTDNGRGIP-----------------VDIHAEEG---------------AAEV 19909735 NADGSVTVTDNGRGIP-----------------TDIHAEEG----------V---SAAEV BAB87063.1 NADGSVTVTDNGRGIP-----------------TDIHAEEG---------------AAEV 19909737 NADGSVTVTDNGRGIP-----------------TDIHAEEG----------V---SAAEV BAB87064.1 NADGSVTVTDNGRGIP-----------------TDIHAEEG---------------AAEV 19909539 NADGSATVSDDGRGIP-----------------TDIHEGEG---------------AAEV 1049326 NADGSVTVTDDGRGIP-----------------VDMHEGEG----------V---SAAEV 16124415 NADGSVTVTDDGRGIP-----------------VDMHEGEG----------V---SAAEV 19909537 NADGSVTVTDDGRGIP-----------------VDMHEGEG---------------AAEV 15892807 NKNGSVTVSDNGRGIP-----------------VEIHGEEG----------I---SAAEV 15604433 NKNGSVTVSDNGRGIP-----------------VEIHEEEG----------I---SAAEV 19909663 NPDGSVSVEDNGRGIP-----------------VDMHKEEG----------V---SAAEV 19909665 NPDGSVSVEDNGRGIP-----------------VGMHKEEG----------V---SAAEV 19909667 NPDGSVSVEDNGRGIP-----------------VDMHKEEG----------V---SAAEV BAB87029.1 NPDGSVSVEDNGRGIP-----------------VDMHKEEG---------------AAEV 19909719 NADGSVSVEDNGRGIP-----------------VDLHKEEG----------V---SAAEV BAB87055.1 NADGSVSVEDNGRGIP-----------------VDLHKEEG----------V---SAAEV 23110554 NPDGSVSVEDNGRGIP-----------------TDIHAEEG----------V---SAAEV 19909581 NPDGSVSVEDNGRGIP-----------------TGIHSEEG----------V---SAAEV 6580765 Y--DSVSVEDNGRGIP-----------------TGIHPEEG----------V---SAAEV 19909695 HSDSSVSVRDNGRGIP-----------------VDMHPSEG---------------VSAA 19909739 HADSSVSVRDNGRGIP-----------------VDMHAGEG---------------VSAA 18157438 HADSSVSVRDNGRGIP-----------------TDIHAGEG---------------AAEV 18157436 HADSSVSVRDNGRGIP-----------------VDMHASEG---------------AAEV 22956830 HADSSVSVRDNGRGIP-----------------VDMHASEG----------V---SAAEV 19909633 ------------------------------------------------------------ 18157440 HADDSVSVRDNGRGIP-----------------VDIHHEEG----------V---SAAEV 23016662 NADGSVLVTDNGRGIP-----------------VDIHPEEG----------I---SAAEV 15643596 HEDGSVEVEDNGRGIP-----------------VDIHPEEG----------R---SALEV 19909675 HEDGSVEVEDNGRGIP-----------------VDIHPEEG----------R---SALEV 19909649 HEDGSVEVEDNGRGIP-----------------VDVHPEEG----------R---SA--V 13878524 HKDGSASVEDNGRGIP-----------------TEMH-ELG----------K---SALEI 15606321 HRDNSVTVEDDGRGIP-----------------VDIHPETG----------K---PAVEM 19909541 NPDGSVTVTDRGRGIP-----------------VDIHPVKK----------K---SALEL 21675071 NPDGSVTVTDHGRGIP-----------------VDIHPVKK----------K---SALEL 21465844 NEDGSLTVEDNGRGIP-----------------VDLMPEEG----------K---PAVEV 15594781 NLDNTITVIDNGRGIPT-------------DIHEEE-GIS----------------ALEL 454038 NLDNTITVIDNGRGIPT-------------DIHEEE-GISV---------------TLEL 6647532 NSDNSVTVNDNGRGIPT-------------DVHEEE-GIS----------------ALEL 4033400 EP-DIVRVEDNGRGIPV-------------DIHPTE-KIS----------------ALEL 15639990 E--QVVRVEDNGRGIPV-------------DVHPHE-GVS----------------ALEV 20090442 NPD-SVTVLDNGRGIPI-------------DPHPVH-KKS----------------ALEV 21228521 NPN-SVTVIDNGRGIPI-------------DPHPVH-KKS----------------ALEV 23050010 NPDGSVTVLDNGRGIPV-------------DPHPFH-KKS----------------ALEV 10644698 KKGNIIQVEDDGRGIPV-------------DMHPKL-KIS----------------ALEV 11270953 HKDNSVTVSDDGRGMPI-------------GIHHKM-KKP----------------TVEV 18308988 HKD-SVTVVDDGRGMPV-------------GIHPKM-GKP----------------TVEV 23020027 HKDNSITNIDNGRGIPV-------------GIHPKL-GIS----------------TVEV 23112429 HKDNSISVVDNGRGIPV-------------DIHPKL-GKP----------------AVEV 20806552 HKDNSITVEDDGRGIPT-------------DIHPKV-GKP----------------AVEV 23054293 HLDGSITVVDNGRGIPT-------------EMHPTE-GKP----------------AAEV 19909691 HDDGSVSVTDDGRGIPV-------------ATHEEY-DRP----------------AVEV 15790024 HDDGSVSVTDDGRGIPV-------------ATHEEY-DRP----------------AVEV 19909603 HDDGSVSVTDDGRGIPV-------------ATHEEY-DRP----------------A--V 121889 HED-SVSVTDNGRGIPV-------------GTHEQY-DRP----------------ALEV 21218890 HEDGSVSVTDNGRGIPV-------------GTHEQY-DRP----------------ALEV 19909689 HDDNSVSVSDDGRGIPV-------------DTHEKY-DRP----------------ALEV 15604910 LEDGGISISDNGRGIPI-------------QIHEKE-SAKQ----------GREISALEV 3510605 LE--GISISDNGRGIPI-------------QIHEKE-SAKQ----------GREISALEV 15618195 LEDGGIVIVDNGRGIPI-------------EVHERE-SAKQ----------GREVSALEV 15791402 TTEGSCIVSDNGRGIPV-------------DMHPTE-NMP----------------TLTV 3695371 TTEGSCIVSDNGRGIPV-------------DMHPTE-NMP----------------TLTV 15611520 TEEGSCIVEDNGRGIPV-------------DIHPTE-KIP----------------ACTV 15645128 TDEGSCIVEDNGRGIPV-------------DIHPTE-KIP----------------ACTV 16082085 GSDGSITVEDDGRGIPV-------------DIHPKY-NRP----------------GLEI 13541372 GKDGSVLVEDDGRGIPV-------------DIHPKY-NRP----------------GLEI 22405936 --DGSISVEDDGRGIPV-------------DIHPKY-KRP----------------GLEI 18916466 FDDGSVEVADNGRGIPV-------------AVHAT--GVP----------------TVDV 7437456 FDDGSVEVADNGRGIPV-------------AVHAT--GVP----------------TVDV 13431552 LDDS-VEVADNGRGIPV-------------AMHAT--GAP----------------TVDV 1107468 LEDGGVEVADDGRGIPV-------------ATHAS--GIP----------------TVDV 15835080 HADGSVEVRDDGRGIPV-------------EMHAT--GMP----------------TIDV 1226021 HAD-SVEVRDDGRGIPV-------------EMHAT--GMP----------------TIDV BAA78449.1 HADGSVEVRDDGRGIPV-------------EMHAT--GMP----------------TID- 7437446 HADGSVEVRDDGRGIPV-------------EMHAT--GMP----------------TIDV 19551255 LEDGGVQVVDDGRGIPV-------------DMHPS--GAP----------------TVQV 21322770 LEDGGVQVVDDGRGIPV-------------DMHPS--GAP----------------TVQV 6729221 LADGGVRVTDNGRGFPV-------------DLHPKL-KKP----------------GVEV 23016964 LAD--VRVTDNGRGIPV-------------DPHPVE-KKP----------------AVEL 1708090 LADGGVRVVDNGRGIPV-------------GIVPSE-GKP----------------AVEV 7437457 LPDGGVRVVDNGRGIPV-------------GIVPSE-GKP----------------AVEV 322319 LADGGVRVVDNGRGIPV-------------GMHPVE-KRP----------------AVEV 22971553 HRDGSVTVSDDGSGIPV-------------GIHPKE-GIS----------------TLTL 4033395 HVDGSLSVQDNGRGIPV-------------GPHPKFPGKD----------------TLEV 6006289 NEDNSITVQDNGRGIPV-------------DFHEKEQK-----------------SALEV 23135434 NENNSITVTDNGRGIPT-------------GVIAKYGK-----------------SALEV 10039315 ------------------------------------------------------------ 13358822 ------------------------------------------------------------ 6939900 LSDNSIQVTDNGRGIPV-------------DMHAKEGK-----------------SAL-- 13517055 ------------------------------------------------------------ 9971355 ------------------------------------------------------------ 13517033 ------------------------------------------------------------ 13517035 ------------------------------------------------------------ 13517065 ------------------------------------------------------------ 21224166 HDDASVEVRDNGRGIPV-------------DVEPKTGL-----------------SGVEV 23017713 HADGSVEVRDNGRGIPV-------------DIEPSSGL-----------------SGVEL 15805931 HADGSATVTDDGRGIPV-------------DIMKSKGR-----------------PAIEV 19568163 HKDQSIEVIDNGRGMPV-------------DIHPVE-----------------KVSGVEV 16273428 HPDQSIEVTDNGRGMPV-------------DIHPTE-----------------GVSGVEV 15602235 HKDQSLEVIDNGRGMPV-------------DIHPVE-----------------KLSGVEV 11270949 HQDNSLEVIDDGRGMPV-------------DIHPEE-----------------GVPGVEL 15600160 HQDNSLEVIDDGRGMPV-------------DIHPEE-----------------GVPGVEL 23103883 HEDNSLEVIDDGRGMPV-------------DIHPEE-----------------GVPGVEL 23060755 HADHSLEVCDDGRGMPV-------------DIHPEE-----------------GVSGVEL 19717679 HADQSLEVIDDGRGMPV-------------DIHPEE-----------------GVPAVEL 16130926 HADQSLEVIDDGRGMPV-------------DIHPEE-----------------GVPAVEL 15803577 HADQSLEVIDDGRGMPV-------------DIHPEE-----------------GVPAVEL 19909673 HADQ--EVIDDGRGMPV-------------DIHPEE-----------------GVPAVEL 16761956 HADQSLEVIDDGRGMPV-------------DIHPEE-----------------GVPAVEL 3421248 HADQSLEVIDDGRGMPV-------------DIHPEE-----------------GVPAVEL 421248 HADQSLEVIDDGRGMPV-------------DIHPEE-----------------GVPAVEL 16120993 HADQSLEVIDDGRGMPV-------------DIHPEE-----------------GVPAVEL 15642428 HADQSLEVIDDGRGMPV-------------DIHPEE-----------------KVSGVEL 23029359 HKDQSVTVTDDGRGMPV-------------DLHPEQ-----------------KKPGVEV 21242463 YKDGSCEVSDDGRGMPV-------------DIHPEE-----------------KIPGVEL 21231148 YKDGSCEVSDDGRGMPV-------------DMHPEE-----------------KIPGVEL 15837887 YKDGSCEVADNGRGMPV-------------DIHPEE-----------------KIPGVEL 9971917 LKDGFIKVSDDGRGMPI-------------DEHPEH-----------------KVSGVEL AAG10479.1 LKDGFIKVSDDGRGMPI-------------DEHPEH-----------------KVSGVEL 22977071 HRDGSISVEDDGRGIPV-------------GIHPEE-----------------QVPVVEI 17545695 HKDGSVSVEDEARGIPV-------------GIHPEE-----------------GVPVVEI 22987032 HVDHSVSVEDDGRGIPF-------------GLHPEE-----------------GVPVVEI 15677530 HEDGSLSVHDNGRGIPV-------------GLHPEE-----------------GVSVVEL 15794824 HEDGSLSVRDNGRGIPV-------------GLHPEE-----------------GVPVVEL 15888935 DAEGFLTVTDNGRGIPV-------------ENHPQVP----------------GKSTLEV 15965186 DADGYLTVTDNGRGIPV-------------ENHPKFP----------------GKSTLEV 17989021 DKEGFVTVSDNGRGIPV-------------DEHPQVP----------------GKSTLEV 23008007 EDTVCLVVTDIVLGIPF-------------DPHP-------------------------- 22964421 TADGFLTVSDNGRGIPV-------------DPHPKFP----------------KKSALEV 13471034 SADGFLTVTDNGRGIPV-------------DPHPKF-----------------KKPALEV 23014487 AVDGTCTVRDNGRGIPV-------------DPHPKYP----------------DKSALEV 22966144 AVDGSVCVRDNGRGIPI-------------DPHPRFP----------------DKSALEV 7437466 NADGSVTVRDNGRGIPV-------------DPHPKFP----------------GKSALEV 22960431 HADHSVTVRDNGRGIPV-------------DPHPKFP----------------GKSALEV 23108729 EEGNRLTISDNGRGIPV-------------DEHPKYP----------------GKSALEV 16126217 DADGFLSVKDDGRGMPV-------------DPHPKYP----------------GKSALEV 4033401 DSNNYLTVTDNGRGIPI-------------ENHPQIP----------------DKSTLEV 15892232 HHDHSITIFDNGRGIPI-------------DNHPKFP----------------DKSALEV 15604098 HQDHSITIFDNGRGIPI-------------DNHPKFP----------------DKSALEV 23001295 HKDGSVSVLDNGRGIPV-------------APHPRYP----------------GQSALEV 15834657 DSQ-KLSIRDEGRGIPL-------------G-------------------------KVID 15605394 DAH-ELSIRDEGRGIPL-------------G-------------------------KVID 23138218 TDK-KVEVRDYGRGIPL-------------G-------------------------KVID 15888043 GGKGLVRITDNGSGMSP-------------ADLELAVR----------------RHCTSK 15964569 GGKTLLRVTDNGIGMSP-------------ADLELAIR----------------RHCTSK 17989371 GGKTLLRVTDNGSGIPA-------------DELALAVS----------------RHCTSK 13476839 GGLNLIRVTDDGSGIPE-------------PELALAIA----------------RHCTSK 22961545 GGRRKIVIADDGSGMTQ-------------ADLALAVD----------------RHATSK 22956645 GGKALIRVTDDGCGMTA-------------DDLPLALS----------------RHATSK 23010126 GGRRLIRVIDDGIGMGP-------------EDLELAVE----------------RHATSK 16124948 GGLTRILVADDGCGLSP-------------EELPVAIE----------------RHATSK 23015547 GGQSLIAVSDDGCGMAP-------------DEMMLAVE----------------RHATSK 23109150 GGLAMIEVSDDGCGMRP-------------DEIALALE----------------RHATSK 15789473 GGTDRIVVADDGRGMTG-------------DDLRMAVR----------------QHTTSK 23104554 GGVKLLRVRDDGCGIAA-------------DDLPLALA----------------RHATSK 15600139 GGIKLLRVRDDGRGIPA-------------DDLPLALA----------------RHATSK 23060778 GGVKLLRVRDDGSGISA-------------DDLPLALA----------------RHATSK 23026526 GGVKLMRVRDNGCGIGK-------------NDLPLALS----------------RHATSK 15804759 GGAKLIRIRDNGCGIKK-------------DELALALA----------------RHATSK 5107506 GGAKLIRIRDNGCGIKK-------------DELALALA----------------RHATSK 16763178 GGAKLIRIRDNGCGIKK-------------EELALALA----------------RHATSK 16767605 GGAKLIRIRDNGCGIKK-------------EELALALA----------------RHATSK 16120706 GGAKLIRIRDNGCGISK-------------DDLALALA----------------RHATSK 15640372 GGAKLIRIRDNGSGIDK-------------DELGLALS----------------RHATSK 15602769 GGSTLIRIRDNGIGIAK-------------DELSLALA----------------RHATSK 22983410 GGVKRISITDDGCGIPE-------------NELALALM----------------RHATSK 13446680 GGVKRISITDDGCGIPA-------------DELPLALM----------------RHATSK 22976701 GGVRRIVITDNGCGIPA-------------DELPVALM----------------RHATSK 17547282 GGVRRIAITDNGGGIPV-------------DELPVALM----------------RHATSK 21243139 GGVRLIRIRDNGGGITP-------------DELPLAVS----------------RHATSK 21231736 GGVRLIRIRDNGGGIAP-------------EELPLAVS----------------RHATSK 15837362 AGGRLIRIRDNGHGMAA-------------QELPLAVL----------------RHATSK 22995446 AGVRLIRIRDNGHGMAA-------------QELPLAVL----------------RHATSK 15677300 GGIRLIRVSDNGGGIHP-------------DDIELALH----------------RHATSK 15794549 GGIRLIRVSDNGSGIHP-------------DDIELALH----------------RHATSK 22955594 GGLKLIRVTDNGGGISG-------------EELPLALT----------------RHATSK 15639295 GGCALIRVSDNGHGMSP-------------QDLLLCAE----------------AHTTSK 21401749 AGLSKIRIIDNGDGIAE-------------EDCIVAFE----------------RHATSK 16078768 AGLASIRVLDNGEGMEN-------------EDCKRAFR----------------RHATSK 16800509 AGLNKITIIDNGSGIEE-------------EDVAIAFL----------------RHATSK 16803444 AGLNKITIIDNGSGIEE-------------EDVATAFL----------------RHATSK 15614931 GGLDRIRVIDDGDGIER-------------EDVETAFF----------------RHATSK 23099087 AGLEEIRITDNGAGMEE-------------DDVERAFL----------------RHATSK 14577936 AGLRLIEVIDNGLGLEK-------------EDVALALR----------------RHATSK 15674190 AGLRLIEVIDNGLGLEK-------------EDVALALR----------------RHATSK 22538232 SGLKKIQITDNGEGMTS-------------EDAVLSLR----------------RHATSK 15675871 SGLKMIQVTDNGEGMSH-------------EDLPLSLR----------------RHATSK 14279172 SGLSKIQITDNGEGMAQ-------------ADVAMSLR----------------RHATSK 15900110 AGLKKVQITDNGHGIAH-------------DEVELALR----------------RHATSK 22991198 AGLRTIQVIDNGEGILA-------------DDVENAFK----------------RHATSK 15924287 SGVQSIRVVDNGSGIEA-------------EDLGLVFH----------------RHATSK 23002387 AGLKQITVQDNGSGIAK-------------DQLNLAFT----------------RHATSK 23023443 AGESLIRVVDNGEGINP-------------EDVPLAFT----------------RHATSK 22971740 GGLREIRVQDDGCGIPA-------------DEIELAFA----------------RHATSK 23112898 SGVERIRVQDNGQGISA-------------EDLPLTVL----------------RHATSK 15895111 GGRTLIKVLDDGYGIDK-------------DDIEKAFM----------------PHATSK 18310138 GGESLIKIIDDGSGVHP-------------EDVEKAFN----------------PHATSK 23021245 GGISFIKVVDNGSGIEE-------------DDIEIAFE----------------RHATSK 20807805 GGIPYIKVTDDGCGMNE-------------IDAVLAFE----------------RHATSK 20089411 GGKHSILIRDNGCGMSK-------------ADALLSYE----------------KHATSK 21227784 GGKRSILIRDNGCGMSR-------------ADALLAYK----------------KHATSK 23051231 GGKRSILVRDNGCGMDR-------------EDALLAYK----------------KHATSK 19703797 GGRD-ISISDSGCGMSK-------------EDLLLSIE----------------RHATSK 21674838 AGRQLVQIIDNGCGMES-------------DDVLLSVE----------------RFATSK 23137831 AGKQLIQVIDNGKGMSD-------------GDARLCFE----------------RHATSK 23053836 GGRRLIRVTDDGSGMSR-------------EDALLSLE----------------RHATSK 23000602 GGKRLMQVVDNGHGMSE-------------DEASLALT----------------RHATSK 15617161 SGFQSIILKDDGCGIDK-------------KDLLLAVC----------------HHATSK 21672810 SGLNSITVKDDGFGIEK-------------DQLLLAIS----------------RHATSK 15893284 AGKNLIIISDDGIGMTD-------------KELEIAVE----------------RHTTSK 15604708 AGKNLIIVSDDGIGMTD-------------KELEIAVK----------------RHTTSK 15606703 GGKRLIRVKDNGTGIHP-------------EDVEKVVL----------------QGATSK 3914082 GGKRLIRVKDNGIGIHP-------------EDIEKVVL----------------SGATSK 15642797 GGKNMVRVSDNGIGMTR-------------EEALLAIE----------------PYTTSK 15835478 GGKGQIVVRDNGIGMDA-------------DEVAVAIQ----------------RHATSK 15605304 GGRGQIVVRDNGVGMDP-------------EEVPVALQ----------------RHATSK 15618721 GGQGAIIIRDNGCGFRA-------------EDIPIALQ----------------RHATSK 23124554 -QQWRIRVADNGCGMNL-------------DDLQQAAT----------------AHSTSK 17230547 -QQWRVRVADNGCGMNL-------------DDLQQAAS----------------AHSTSK 23040870 -EQWRVQISDNGMGMNL-------------ANLKRAAN----------------PHSTSK 16329972 -DQWRLEVLDNGQGMDV-------------TELKTSVL----------------PHATSK 15806699 GGLERVQVRDNGSGIAA-------------QSVPLAPA----------------RHATSK 15594556 GGIQKILIIDNGSGISK-------------EDLKICYL----------------PHTTSK 21287814 GGLRSLQIQDNGTGIRR-------------EDLGIVCE----------------RFTTSK 17136968 GGLKLLQIQDNGTGIRR-------------EDLAIVCE----------------RFTTSK 13878583 GGLKLIQIQDNGTGIRK-------------EDLDIVCE----------------RFTTSK 13591989 GGLKLIQIQDNGTGIRK-------------EDLDIVCE----------------RFTTSK 4557757 GGLKLIQIQDNGTGIRK-------------EDLDIVCE----------------RFTTSK 460627 GGIKVLQITDNGSGINK-------------ADLPILCE----------------RFTTSK 19112991 GGLKLLQITDNGSGIQY-------------DDLPYLCQ----------------RFSTSK 11357265 GGLKLIQVSDDGHGIRR-------------EDLPILCE----------------RHTTSK 20146218 GGLKLIQVSDDGHGIRF-------------EDLAILCE----------------RHTTSK 13517948 GGLELLQVTDDGHGIRF-------------GDLPLLCE----------------RYATSK 17554324 GGLKLLQVSDNGKGIER-------------EDFALVCE----------------RFATSK 19173567 DGLT-LTVEDDGDGIHE-------------SDFELLCK----------------QYCTSK 17136970 QGLQSVEVSDNGSGVEE-------------MNLEG----------------MTAKYHTSK 3193224 QGLQSVEVSDNGSGVEE-------------MNLEG----------------MTAKYHTSK 21291966 CGAELVEVSDNGSGVEE-------------KNFAGLIMASNAPPFLPIFLSKAAKYHTSK 1304121 YGVDLIEVSGNGCGVEE-------------ENFEGLTL----------------KHHTSK 4239950 YGVDLIEVSGNGCGVEE-------------ENFEGLTL----------------KHHTSK 1082696 YGVDLIEVSGNGCGVEE-------------ENFEGLTL----------------KHHTSK 1082697 YGVDLIEVSGNGCGVEE-------------ENFEGLTL----------------KHHTSK 4885551 YGVDLIEVSGNGCGVEE-------------ENFEGFTL----------------KHHTCK 22046253 --MDLIEVSGNGCGVEE-------------ENFKGLTL----------------KHHTSK 22046611 YGMDLIEVSGNGCGVEE-------------ENFEGLTL----------------KHHTSK 18568033 ------------------------------------------------------------ 4239952 YGMDLIEVSGNGCGVEE-------------ENFEGLSLS-------------ALKHHTSK 17942771 YGVDLIEVSDNGCGVEE-------------ENFEGLTL----------------KHHTSK 21619309 YGVDLIEVSDNGCGVEE-------------ENFEGLTL----------------KHHTSK 17942780 YGVDLIEVSDNGCGVEE-------------ENFEGLTL----------------KHHTSK 20848664 YGVDLIEVSDNGCGVEE-------------ENFEGLAL----------------KHHTSK 6679397 YGVDLIEVSDNGCGVEE-------------ENFEGLAL----------------KHHTSK 12851890 YGVDLIEVSDNGCGVEE-------------ENFEGLAL----------------KHHTSK 1082698 YGVDLIEVSDNGCGVEE-------------ENFEGLTLS-------------ALKHHTCK 7487015 YGEDYFQVIDNGCGISP-------------TNFKVCVQILR-----RTFDVLALKHHTSK 172203 YGLESIECSDNGDGIDP-------------SNYEFLAL----------------KHYTSK 19880897 YGLESIECSDNGDGIDP-------------SNYEFLAL----------------KHYTSK 19880904 YGLESIECSDNGDGIDP-------------SNYEFLAL----------------KHYTSK 19115329 YGINSIEVVDNGSGIDA-------------GDYESIGK----------------KHFTSK 14250028 YGFDKIEVRDNGEGIKA-------------VDAPVMAM----------------KYYTSK 4505911 YGFDKIEVRDNGEGIKA-------------VDAPVMAM----------------KYYTSK 20810039 YGFDKIEIRDNGEGIKA-------------VDVPVMAV----------------KYYTSK 22204384 YGLDRIEVRDNGSGIKA-------------TDVSVMAV----------------KHYTSK 17562796 NGFESIEVQDNGSGIEA-------------RNFDALCK----------------PHSTSK 15237032 VVSCSVKVVDDGSGVSR-------------DDLVLLGE----------------RYATSK 13027781 SGAGNITVEDDGSGMDLSYLLDSEGRLKEDASLPLLAS----------------RATTKR 19074926 LVDDAITVEDNGCGISD-----------------------------------LDKVGVEG 12964795 -------------------------------------------------------VPDEV 22971450 PPTGLIQVSAESSG-----------------------------------------NEVRI 23133974 ------------------------------------------------------------ 21229586 ------------------------------------------------------------ 19703117 --------------------------------------------------------AIAE 14602026 PAELFTRIKDFRR-------------------------------------------KIAI 20850207 ------------------------------------------------------------ 3023302 ------------------------------------------------------------ 15223829 LTSFAYPLEG-GLG--------------------------------------------EV 23054515 RVEVQNAITAGRAG------------------------------------------TVVN 2251101 PRKYIVKLKHN--------------------------------------------DDVKD 23107981 VDYEVRIVDHEDNDLPR---------------------------------------GVEG


16081092 EVRRD------------------PF-GDLIKVS-----------------VTDTGIGIAK 16126721 EVRRD------------------PF-GDLIKVS-----------------VTDTGIGIAK 22963829 AVE-----------------------GTRLVLR-----------------VTDTGVGIAE 22989182 SVFAQ------------------ADGVQTLEMT-----------------VEDTGIGIAP 17547798 KCMET------------------AADTVHLIIR-----------------VTDTGIGIAP 22979217 SVEPT------------------SAGEDVLVVS-----------------VADTGIGIA- 23013649 TLVPD------------------G-----LALV-----------------VSDTGIGIAP 22967281 RGDED------------------KG---QMVIE-----------------VSDSGIGMAP 22998770 EKS--------------------SDDATNLLFH-----------------VIDSGIGIAK 23125239 HLT--------------------PADVT---ID-----------------IQDTGPGISK 22998928 QPM--------------------ANGLE---IR-----------------VKDSGAGINR 22999655 SMRD-------------------PQQLA---LV-----------------IRDTGIGVDA 22999372 KQVE------------------ANDREVMLQFS-----------------ISDSGIGMT- 23016213 ELVE------------------RSEDQAELHFW-----------------VRDSGIGMT- 23001019 TAEL------------------DCESHVVVQFQ-----------------VRDSGIGMT- 23102095 RKEC------------------EDERGVRLRFE-----------------VRDTGIGLE- 23016211 RLLE------------------DLGAEVMLRFE-----------------VRDTGIGLTE 16330584 RLQE------------------YRDQDVVLYLA-----------------VKDTGIGIK- 15641361 RVSQ------------------LNEQQVTLRFA-----------------VKDTGIGIA- 22998978 AVDR------------------YLEEQVVLHFS-----------------VRDSGMGMQ- 22998577 TRHT------------------QRGELLELCFT-----------------VRDTGIGME- 22999846 EKVQ------------------QQGDQIVLRFS-----------------VQDTGIGME- 23000440 EVIQ------------------SAERQVKVRFS-----------------VKDTGIGLT- 22999533 EPLH------------------QQEQELLLKFS-----------------VIDSGMGMS- 22999650 KLQG------------------VFDGRVTLYFE-----------------VRDSGIGMED 22999289 DAKQ------------------QREQHYLLHFS-----------------VQDTGIGIS- 16330590 QLLK------------------TENEQTKLQFS-----------------VTDTGIGLT- 22998460 GWQA------------------GQGTAGVLHFS-----------------VKDTGVGIA- 22999474 EQVA------------------HSEHRLRLRFS-----------------VKDSGVGIP- 23000229 TAEPY----------------VQLTDHYLFTFE-----------------VKDSGIGIP- 23001466 YGNE-----------------PTPEGRCLLRFE-----------------VIDSGIGIE- 23000654 AQQA------------------KREDSLLLQFE-----------------VQDSGIGIP- 23027858 QK-AS--------------SVQCSTEEYAIEFV-----------------VSDTGIGI-A 22963532 QK-AS--------------SVQCSTEEYAIEFV-----------------VSDTGIGI-A 13591555 QK-GN--------------DVTCLPNEYMIEFV-----------------VSDTGIGI-T 16904238 QK-AE--------------QDHCAPNEYAVEFC-----------------VSDTGIGI-A 5225252 KERVE--------------QRNVRPGEYAVEFI-----------------VEDTGIGA-K 16329802 KERVE--------------QRNVRPGEYAVEFI-----------------VEDTGIGA-K 20198952 KV-----------------EKSLSCGEVVLKFS-----------------VIDTGIGIPK 23053202 EP------------------VQQSDAEVLIRFS-----------------VADTGIGIAP 21885294 RS------------------QSLPEGEINLSFS-----------------IKDTGIGIL- 21243225 RR-----------------FPSGDPNKFKLLFS-----------------VRDTGIGI-S 21231797 RR-----------------FPSGDPNKIKLLFS-----------------VRDTGIGI-K 23102206 SR----------------RRKSDGSEH--LYFG-----------------VSDSGIGIR- 15598658 QR----------------RFDEGGRER--LLYS-----------------VSDSGIGIS- 23020868 DI----------------IEKRDDSVK--LKFT-----------------VSDTGIGID- 23112091 KR----------------LQGDEDVSD--LKFT-----------------VMDTGIGIE- 23053622 DA----------------DPAGGN-----LLFT-----------------VSDTGIGIK- 23055398 ER----------------APSSGTDDGVMLLFT-----------------VSDTGIGIA- 23020543 ------------------MLEDETEEHAQLRIS-----------------VQDTGIGLS- 1346440 ------------------MLEDETEEHAQLRIS-----------------VQDTGIGLS- 463195 ------------------MLEDETEEHAQLRIS-----------------VQDTGIGLS- 14906039 ------------------MLEEEHEDSVQLRIS-----------------IQDTGIGLN- 10178628 ------------------MLEEEHEDSVQLRIS-----------------IQDTGIGLN- 23059895 ------------------MLEEENDDSVQLRIS-----------------IQDTGIGLN- 2439990 ------------------MVEDEEEDSVQLRIS-----------------VQDTGIGLS- 808104 ------------------MVEDEEEDSVQLRIS-----------------VQDTGIGLS- 13641117 ------------------GR-DEQEDSVQLRIS-----------------VQDTGIGLS- 15596125 ------------------MLEDESDDRAQLRIS-----------------VQDTGIGLE- 23102809 ------------------MVEDIGEEFAQLRIS-----------------VHDTGIGLQ- 23105439 ------------------EVRPDGTEYWLLTGS-----------------VRDTGIGMA- 23001649 ------------------TVERQDADTVTVLTE-----------------VRDTGIGIE- 23027374 R-----------------QVNASDADLPMIHFS-----------------VEDSGIGIS- 23026365 ------------------KLDSEINGLNQLRCS-----------------VTDTGIGIS- 23027857 ------------------SLTKNTSGFN-LNIS-----------------VADTGIGIAE 23014385 R-----------------ALD-PRERPLRLEFN-----------------ITDTGIGLS- 23015108 T-----------------LLERPGAQPM-VHFD-----------------VRDTGIGIP- 21241265 R-----------------RLGETRAQHL-LRFQ-----------------VRDTGIGIA- 21229958 R-----------------RLGETRAQHL-LRFQ-----------------VRDTGIGIA- 16329648 KGEPFDPAESYHT-----ILNLPHPSHR-ICFN-----------------LRDTGIGIPL 3955036 KGEPFDPAESYHT-----ILNLPHPSHR-ICFN-----------------LRDTGIGIPL 23126935 ELRSLS------------------STTATIYFA-----------------ITDTGLGITF 17231253 ELRSET------------------PTTAIIHFA-----------------VTDSGLGITL 17229771 GAKQK-------------IYKQTDPTRYEFQFA-----------------VQDTGIGE-R 22298825 GVLKR-------------EGKD------FLQFQ-----------------VQDTGIGIPR 22298419 KAKPMPM-----------SQYEFMPSYYSYLFA-----------------IQDT-GGISA 17230367 RSQPS--------------PNQKNKNCCEIIFT-----------------IKDTGIGIAP 16761737 E-KRA-----------------LSNTKVQIEVQ-----------------IRDTGIGIP- 16766264 E-KRA-----------------LSNTKVQIEVQ-----------------IRDTGIGIP- 15803307 E-KRA-----------------LSNTKVQIEVQ-----------------IRDTGIGIP- 2073556 E-KRR-----------------QELHQVLLEVQ-----------------IRDTGIGIA- 2463029 E-KRR-----------------QEHHQVQLEVQ-----------------ICDTGIGIA- 16123530 V-VKA-----------------IASQQVTLMVE-----------------IHDTGIGISE 15642449 E-MRA-----------------LRDDVIDLQFM-----------------VRDTGIGIS- 23053150 E-PEASS---------------LASQEMQLIFT-----------------IQDTGIGIP- 23000161 HLQPGKA---------------EASDQQELCFR-----------------VVDTGIGIS- 23000657 STTAGKG---------------S---QVEIVFR-----------------VIDTGIGIP- 23026553 SKDQSSE---------------N---QFTLKFR-----------------VTDSGIGLS- 23013889 SVDDSIPPTN------------TEEEIIHLCIT-----------------IEDTGIGIPQ 13472804 ARARSETSD-------------------RICFT-----------------ITDTGPGLRE 22999284 SVAEQ-----------------------QLCVM-----------------VRDTGLGIED 16124840 Q------------------RNDDGM----LEIA-----------------VADTGIGIA- 16124905 IW-----------------RGELEE----LFVA-----------------VKDTGIGID- 23001602 ER-----------------LETPVAS--WIRIS-----------------VKDTGIGIA- 22998518 RP-----------------GPRNGPERSDYRFS-----------------VSDNGIGIP- 22979714 LL-----------------IADH-PETQTIQLE-----------------VSDTGIGIP- 23012559 R-------------------RDG--EGNRYEFS-----------------VIDTGIGLE- 23012953 EP-----------------LAVE--RGQVLRFL-----------------IKDTGIGIG- 15601465 RL-----------------APDG----QGIRFA-----------------VEDSGIGIE- 15600175 ER-----------------LARSAG-SERLRLS-----------------VADDGIGIP- 22962312 ER-----------------GDQSG----ELRII-----------------VRDTGIGIA- 16124282 QRRIT---------------D----AGPYLVFD-----------------IIDTGVGVPL 16127421 SGRRI---------------DSPDGARLRLRFE-----------------IDDTGVGIGE 16126740 RQTID---------------GD----QAVLRGE-----------------VTDTGIGIAP 16127449 ASAED---------------G------SGLRID-----------------VADTGIGISE 16127218 RP------------------GEAPG---AVVFD-----------------VADTGIGMTE 16127332 G-------------------GEAGG---VVTLS-----------------VTDTGVGMTE 22998767 RHDAA---------------RSAAG---AVLLQ-----------------VRDTGVGMAE 23014840 GR--C---------------GTDEQGRVMVSIR-----------------VVDTGIGIEA 22954099 VP--A---------------DRANGDVVTVLFQ-----------------VIDNGIGDDA 22961592 TCVKR---------------NDS---HATVEWQ-----------------VTDTGIGISD 22963653 ECISR---------------DTT---NARMRWI-----------------VTDTGIGIAD 23000388 LVHER---------------IDD---IVWVELA-----------------VQDQGIGIAE 22959449 ERLAG---------------GHR------FRFT-----------------VSDTGPGIAA 22967730 DRLAE---------------APEG--KVILHIT-----------------VDDTGIGIAS 13473203 TG-ER---------------VPT---GTRLTIS-----------------VTDTGIGIPE 13473249 GG-ET---------------VND---VVQLRLR-----------------VEDTGIGIP- 22958049 VGLEV---------------APG---RHDLRVT-----------------VEDTGIGIA- 21398939 DSIETSNL----------SHDMQSISKDWITIS-----------------VKDT-IGIAK 22988264 APAEGG----------------------MLRID-----------------VRDSGIGIAP 13472176 RVEKTGRR---------NGARQPKR---ALAIA-----------------VTDTGIGIPE 23125110 TMSS-------------DAAQIDNP---MVAFA-----------------VSDTGIGIPE 21224094 RPAR-DEVPTAIREQLLEAGSMNDPDAELIAFS-----------------VSDTGIGIAA 21225602 EPAPDDEVPGGV----VRGG----P---VVAFR-----------------VKDTGIGIPE 23019494 EPAWAVED--------IDVDTFTDPD-EVIAFS-----------------VIDTGIGIPE 23020660 EMDKDREN--------------------DLIFS-----------------VTDTGIGIPE 22999729 AKSDHPQY--------------------PIRLS-----------------VTDTGIGISK 21242035 QASAPG----------------------RVRFA-----------------VTDTGIGIAE 21230642 QSHGNG----------------------RVRFV-----------------VCDTGIGIAE 22998198 --------------------VRDQQRTLWFGIA-------------------DSGVGIAP 23000653 --------------------LDEAVERLRIEVE-------------------DSGIGIP- 23000375 --------------------DPEDATYLRIEVR-------------------DSGIGLH- 23000437 --------------------SIEQEKTLLFKIT-------------------DSGIGIP- 23001024 ----------------------YANQQFWYAVV-------------------DSGVGIGS 22999127 --------------------QP-AGSLFSITIS-------------------DSGIGIA- 22999563 --------------------LSQQGEMVKLKFS-----------------VVDSGCGIP- 22999905 --------------------SLDANQHIHTR-------------------VSDTGIGIPQ 23000166 --------------------FTDTLERTLVRLC-----------------VKDTGIGIPE 22999962 --------------------SRGVADRTFFK-------------------VSDTGVGIAA 23014204 --------------------ELEPG-HLIFR-------------------VSDTGAGIPG 22998278 --LQQQPDG-------------------QYSFQ-----------------VADTGPGIAH 23000401 --AKPIETG-------------------RLQFT-----------------VSDTGIGMPQ 22999159 --LNPLADG-------------------RLSFV-----------------IRDTGIGVVE 22999727 --AQTMAED-------------------EICFS-----------------VFDSGPGIAE 22998631 --DCEDAGG-------------------WLYFR-----------------VQDSGIGMKA 22998646 --LSKGPGN-------------------RIRFS-----------------VSDSGIGIDQ 23126479 --VEVLLGDIT---------N--------LRFY-----------------IQDTGIGSPQ 23128323 SSVDQLLTNES---------NQ--KPIHKIRFQ-----------------IIDTGGMSQE 23130312 ---TQVINQES---------NANGKTNYKIRFE-----------------VVDTGTGTPE 17228134 --VQRTGLEES---------DP----RTKLRFS-----------------IVDTGVGIAA 23129372 --VEAISNEET---------ADT--RSTRIRFL-----------------VEDTGIGIPE 17228884 --VETIEESST---------QKP--VKHRIRYC-----------------IEDTGIGIDA 23127221 --VETPNQ------------NITPDEPITLNFS-----------------VEDTGCGIAS 23129844 --VAMENMGE----------KILP-HPPHLFFE-----------------VTDTGRGIAP 16330678 --VKCLTAPQT---------DEGQGASIWLHFL-----------------VSDTGP-IAA 22298910 --VSYRAQ-----------------EPPRLAFE-----------------VSDTGIGMTQ 23000906 --AYFTSSSE---------------VPYGLGFE-----------------ISDTGIGIDT 15889688 AYRSQ-----------------------VASFT-----------------VSDTGRGIAE 23011796 SYRSQ-----------------------VAVFS-----------------IRDTGLGIPE 15803750 RYDEGD----------------------MLHFE-----------------VEDSGIGIPQ 16131100 RYDEGD----------------------MLHFE-----------------VEDSGIGIPQ 16762090 RYDEGD----------------------MLHFE-----------------VEDSGIGIPQ 7212861 MRNQD-----------------------CYHFI-----------------VKDTGMGISP 15602178 KRVSEY----------------------QISFS-----------------VSDTGIGIPA 1122856 RTDGE-----------------------QWLVE-----------------VEDSGCGIDP 15800913 RTDGE-----------------------QWLVE-----------------VEDSGCGIDP 16120593 RRQNQ-----------------------TLCFT-----------------VEDTGCGIDV 21243758 TTLSQHT-------------------RQGLRVE-----------------VRDTGPGMSA 21232279 LPL-QAG-------------------GGGIRVE-----------------VSDTGPGMSE 23121089 ERL---T-------------------PQGVRFE-----------------VSDTGPGLN- 21243755 TTLGS---------------------YQGLRFE-----------------VADTGPGINA 21243756 TTLGS---------------------YQGLRFE-----------------VADTGPGINA 21232278 SQHG-----------------------DCLRFK-----------------VRDSGPGIGP 23101880 DVVFSHE-------------------EDMVHVQ-----------------VRDTGIGMTP 20090861 EVYMPSERNSGLSN--------SDFPEEVALLF-----------------KKDTGIGIPP 23135284 EISGRIPHSSS--------------TDITFEFT-----------------VKDTGIGIPQ 16330151 GVEGIQVRSQG--------------TYISLAIE-----------------VTDTGIGIAP 1679757 RIFTNTKSALSN-------------DEIMLEFA-----------------VIDTGRGFTK 22086084 KILEKSNSSLK------------------LSFQ-----------------IIDTGVGIPE 22967903 MDVGEAVG-----------------DQIPLTLS-----------------IIDSGVGMDA 19115322 MAIDEEINAEE--------------NQCKLRFE-----------------IEDTGIGLKE 23103341 QASSEN-----------------------VRLV-----------------IRDTGIGISR 23058955 STWKDG-----------------------VRIE-----------------VCDTGIGIAQ 15599307 RRLAHDAHLV------------------RLRVL-----------------VADTGIGISA 22968449 GVLAREDDRL------------------TMRMA-----------------VSDTGIGIAA 15596808 EWQALDHDVL------------------WLTCA-----------------VHDSGIGI-P 23059907 QWQSLDHELL------------------WFTCA-----------------VRDSGIGISP 22999065 YLEEGAPAQL--------------------HIN-----------------VSDSGSGIPE 22999855 WGLEQQPVPLPS--------------WVSMRFG-----------------VVDSGVGIAA 16761198 R------CDGD-----------------YLSIR-----------------VRDTGVGIPA 16765598 R------CDGD-----------------YLSIR-----------------VRDTGVGIPA 147525 R------ADGD-----------------YLSIR-----------------VRDTGVGIPA 15598240 QERSLDE-GRA-----------------IVRVD-----------------VEDSGIGIAP 23058959 DVLPTDDPERS-----------------MVQLT-----------------VQDSGIGITT 17231257 K-----DLPGS-----------------WVEIK-----------------VKDTGIGIAA 4336932 --EELRLDAP----------------LGMITFT-----------------VTDTGIGMSR 17231988 --EDFLPEMP----------------FGAISFT-----------------VSDTGIGMSS 23041286 NDEDFISQNRDCNF------------TDKVLIL-----------------SVATGIGISE 22974516 --------------------------TAEIQID-----------------VSDTGIGIAA 22972340 ---------------------------NEIVLW-----------------VRDTGIGIAP 23125546 QEGDE------------------------VLLT-----------------IKDTGRGIPT 17229920 HYGDE------------------------LLLT-----------------VKDNGRGIPA 17232665 EKGELEKSQTPIPLY--PQTPIPLYPHPIILFA-----------------VKDQGRGIPA 22972652 EQGM-------------------------VRFS-----------------VRDWGPGISA 23125524 HDG--------------------------VCIS-----------------VIDTGIGIAE 17228319 KDG--------------------------VCIS-----------------VIDTGVGIAE 10957449 PSGDR------------------------VRFT-----------------VQDTGIGLSD 23055072 EW---------------------------YVTS-----------------VADSGIGIKE 1352397 S----DTRAA-------DFFVVPTGSHFYLRVK-----------------VKDSGAGINP 22095655 S----DNRAPP------DFFVVPTGSHFYLRVK-----------------VKDLGAGINP 22095657 SETFREIRVP-------DFHPVPSDSHFYL-VQ-----------------VKDTGSGISP 22095684 AETFREIRVP-------DFHPVPSDSHFYL-VQ-----------------VKDTGSGISP 15131529 SESLRDFRAA-------DFFPVQSDNHFYLRVQ-----------------VKDSGSGINP 18252319 SESLRDFRAP-------DFFPVQSDNHFYLRVQ-----------------VKDSGSGINP 14572558 SESLRDFRAP-------DFFPVQSDNHFYL-VQ-----------------VKDSGSGINP 18252341 SESLRDFRAP-------DFFPVQSDNHFYL-VQ-----------------VKDSGSGINP 21666555 SESLRDFRAP-------EFFPAQSDNHFYL-VQ-----------------VKDSRSGINP 22095685 SESLRDPRAP-------DFFPICGENQFYLRVQ-----------------VKDSGLGINP 22095686 SESVRDPRAP-------DFFPVSSDNQFYMRVQ-----------------VKDSGSGINP 20091095 SESLIDPRAP-------EFFPVQSENHFYLRVQ-----------------VKDTGSGINP 17231039 SESLIDPRAP-------EFFPVQSENHFYL-VQ-----------------VKDTGSGINP 22095654 SESLIDPRAP-------EFFPVQSENHFYL-VQ-----------------VKDTGSGINP 17646113 SESLRDPRAP-------EFFPVQSENHFYL-VQ-----------------VKDTGSGISP 17646115 SESLRDPRAP-------EFFPVQSENHFYL-VQ-----------------VKDTGSGISP 22095659 SDSLRDPRAP-------EFFAVPSENHFYL-VQ-----------------IKDTGIGITP 7407123 SESFLDSRTP-------EFFPVPSDNHFYL-VQ-----------------VKDSGSGISP 7547007 SESLRDSRAP-------DFFPVHSDNHFYL-VQ-----------------VKDSGAGIDP 15598020 PEYARDCHPP-------EMFPMPSDGQFYL-VQ-----------------VRDTGCGISP 21232277 PEYARDCHPP-------EMFPMPSDGQFYL-VQ-----------------VRDTGCGISP 4210924 PEYARDCHPP-------EMFPMPSDGQFYL-VQ-----------------VRDTGCGISP 7652766 PEYARDCHPP-------EVYPMPSDGQFYL-VQ-----------------VRDSGCGISP 4154359 PDSLRDPRDP-------EFYPIPSDGHFYLRVQ-----------------IKDTGCGISP 4650821 PDSLRDPRDP-------EFYPIPSDGHFYLRVQ-----------------IKDTGCGISP 4164161 PDSLRDWRPP-------EFYPISTDGHFYLRIQ-----------------VKDSGCGILP 4138853 PESLQDWRPP-------EFYPTSSDGHFYI-VQ-----------------VKDSGCGIPP 20090015 GD--------------------------MVEIS-----------------VKDEGIGINE 21228280 ED--------------------------MIEIS-----------------VEDEGIGIQE 20091382 GD--------------------------TVEIT-----------------VKDYGIGIKV 21229203 GD--------------------------LVEIT-----------------VKDKGIGIK- 21228731 GE--------------------------FLETT-----------------VTDIGIGIKP 20092182 GN--------------------------LVEIT-----------------VTDAGIGIKA 20091132 GD--------------------------QAKIM-----------------VKDTGIGISK 21227050 EG--------------------------VLEVK-----------------VSDNGIGIS- 20091380 DG--------------------------FLKIT-----------------VADDGIGIAA 21229201 NN--------------------------FIEVS-----------------VSDEGIGIAA 20093164 GS--------------------------RALFS-----------------VTDTGIGISS 23052557 GN--------------------------RALIS-----------------VIDTGIGISA 23052223 GN--------------------------RAIFS-----------------VTDTGIGISS 21228983 EK--------------------------GVRVS-----------------VSDTGIGISK 21229307 ED--------------------------SVRIS-----------------VSDTGIGISE 20090805 GN--------------------------MVRIC-----------------VKDTGIGISR 20091183 GD--------------------------MLQLS-----------------VKDTGIGITE 20092217 GL--------------------------LVTIE-----------------VKDTGIGIP- 17980436 GD--------------------------DIVFT-----------------VRDSGEGIPK 15641456 KD--------------------------GVVFR-----------------VKDTGIGIEK 1754642 QSQG-----------------------HHCILQ-----------------VQDTGIGIVK 17232455 QSQG-----------------------HHCILQ-----------------VQDTGIGIVK 23126551 KSEQ-----------------------DRCILQ-----------------VQDTGIGIVK 18030059 SEAT-----------------------AQHELAAPGYRVC----------VEDTGMGIED 2765035 ECVD-----------------------SQAEIK-----------------VSDTGKGISP 23126883 ERVD-----------------------EQAHII-----------------VSDTGKGINP 23127256 ERVG-----------------------TQAQIQ-----------------VSDTGKGINP 23125853 EQAD-----------------------GYAQII-----------------VSDTGKGISP 17227678 DKME-----------------------GYAQIV-----------------VSDTGKGIQP 23128069 MEAS-----------------------NQIQIQ-----------------VSDTGKGINP 17230934 KAVN-----------------------DQAQIQ-----------------VIDTGKGITP 23124340 ERID-----------------------SQAQIT-----------------VSDTGKGISP 23126892 EQVG-----------------------LDAQIQ-----------------VIDTGKGIIP 17232702 EQVG-----------------------RDAQIQ-----------------VIDTGKGITP 23127009 EQVG-----------------------SQVQIC-----------------VTDTGKGIAP 17228473 EQVN-----------------------LYAQIQ-----------------VKDSGKGIAR 23125940 ESTN-----------------------TYTQIQ-----------------VSDTGKGITP 17230767 ERVN-----------------------NSAQIQ-----------------IQDNGKGISS 17230584 ERVG-----------------------SLAHIQ-----------------VRDTGKGISL 23126274 SSSGEL-------------------ASHSALIQ-----------------VKDTGQGISP 17231477 EQVE-----------------------TNVQIQ-----------------VIDTGTGISP 23123945 QAVG-----------------------TDALLQ-----------------VKDTGNGIKA 23129209 TSVD-----------------------RHAQIQ-----------------VSDTGKGIQP 23125015 SIVYGE--EQQ-----------TTQK--YAQIQ-----------------VIDTGIGISS 17229338 EGING---ELS-----------DDLT--HAQIQ-----------------VIDTGVGIAS 17229296 TKNPGC--EQN-----------ELITNNYAQIQ-----------------VIDTGIGINS 17229208 EYTYF-----------------------QAQIQ-----------------VKDTGAGIKA 23125906 SKEMGSREEFS-----------QPAIPNYLQIE-----------------VTDTGKGISP 23126863 ERIE-----------------------SSVQIR-----------------VSDTGVGIA- 21244408 ERDD-----------------------GHLVVS-----------------VCDSGDGIAA 21233072 EHDD-----------------------GHFIVS-----------------VRDSGDGIAS 17549399 QAGA-----------------------DGLVAT-----------------VRDTGIGIEP 21242798 DVED-----------------------ERLRLC-----------------VQDTGIGIA- 21231592 EVEE-----------------------QRLRLC-----------------VRDTGIGIA- 22970619 RG---------------------EPERGAVRFT-----------------VWDTGIGISA 22972228 TT---------------------DTTQGTIAFT-----------------VSDTGIGIAE 23125527 KK---------------------VPQ--GITFT-----------------VSDTGIGIDP 16331636 KA---------------------TDK--ALIFS-----------------VIDTGIGIDP 17229180 WV---------------------EED--TSIFQ-----------------VEDTGIGIEE 8953946 WR---------------------EGD--RAIFQ-----------------VSDTGIGIES 22298442 WW---------------------KED--ELIFQ-----------------VQDTGIGIPA 17230612 TQLSP------------------DISTVQNFLQ---------------IAVIDTGIGIMQ 16331796 DLIKEQG---------------KENSQSPPQLS---------------FTVFDTGIGEAD 17231589 WLEEVGT---------------NETLGAEKLISQSSIPSP------HIFRVTDTGIGIAS 23128501 Q----------------------PNSTNEYIF----------------FSVVDTGIGMLS 15614576 KVKKK-----------------------RAVIR-----------------VKDTGIGMDE 15640642 TYIDD-----------------------KVRVQ-----------------VVDTGQGIPA 22986735 TRTGR-----------------------RLSLR-----------------VKDNGRGIPA 23121548 RQDGG-----------------------FLWIQ-----------------VSDTGIGIPA 23039579 ELIDV---------------------NKKMAIT-----------------VSDTGIGIPE 23043880 ELIDLKN-------------------NPKMAIT-----------------VSDTGIGIP- 23039991 SLYSPKEDQDE---------------ATEIIIM-----------------VSDTGIGIP-