Lactobacillus johnsonii                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : DNA polymerase beta-like, second domain Fold name : SAM domain-like No of Sequences : 2 Average size : 33 Diversity : 0.090572 Taxonomy       Alignment       Dendrogram Taxonomy [Help] superkingdom      Bacteria phylum      Firmicutes order      Lactobacillales family      Lactobacillaceae genus      Lactobacillus Taxonomy       Alignment       Dendrogram Alignment [Help] 42519408 --ITSS-ERLKDIQ--TELEYYQRIGYPVFEDAEK 42519575 QWVQTGLASLAHIKYDKQLEFKRNQVVNLLHKADL Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 2 sequence  
Superfamily name : DNA polymerase beta-like, second domain Fold name : SAM domain-like No of Sequences : 2 Average size : 33 Diversity : 0.090572