Lactobacillus johnsonii                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : Rad50 coiled-coil Zn hook Fold name : Antiparallel coiled-coil No of Sequences : 1 Average size : 181 Taxonomy       Alignment       Dendrogram Taxonomy [Help] superkingdom      Bacteria phylum      Firmicutes order      Lactobacillales family      Lactobacillaceae genus      Lactobacillus Taxonomy       Alignment       Dendrogram Alignment [Help] 42519392 LEKEQAKKKELEEVAQTQRAKMDQLKTDLTDFDEAYQKLQA 42519392 LSNLNSDLAVVKNKLENITTKKSELEEQLENTNSRL 42519392 LEEKRKQSNERHAEKDEKQQELLSLTQKIAALTTDLQMHQQSREYDVATQKEYNAQSEE 42519392 KERRKRLLDQLAANEKDLNSQNQVLADFVEKQKNLKQELK Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 1 sequence  
Superfamily name : Rad50 coiled-coil Zn hook Fold name : Antiparallel coiled-coil No of Sequences : 1 Average size : 181