Mycoplasma pulmonis                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : LuxS/MPP-like metallohydrolase Fold name : LuxS/MPP-like metallohydrolase No of Sequences : 1 Average size : 106 Taxonomy       Alignment       Dendrogram Taxonomy [Help] superkingdom      Bacteria phylum      Firmicutes class      Mollicutes order      Mycoplasmatales family      Mycoplasmataceae genus      Mycoplasma Taxonomy       Alignment       Dendrogram Alignment [Help] 15828560 DIRNFINQIIIDTMKVKKGYVIEGRDTTFKLAPDAEVRIFLDASSPIRARRRVLQN 15828560 QLNTESNYEKILDNINKRDYSDRNREVDPLHVAQGVIAIVNDHMNIE Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 1 sequence  
Superfamily name : LuxS/MPP-like metallohydrolase Fold name : LuxS/MPP-like metallohydrolase No of Sequences : 1 Average size : 106