Rhodococcus sp. CIR2                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : Rubredoxin-like Fold name : Rubredoxin-like No of Sequences : 1 Average size : 49 Taxonomy       Alignment       Dendrogram Taxonomy [Help] superkingdom      Bacteria phylum      Actinobacteria order      Actinomycetales family      Nocardiaceae genus      Rhodococcus Taxonomy       Alignment       Dendrogram Alignment [Help] 4586295 CEVCEDVYDPRLGDPEGGISPGTAFQDIPDDWVCPVCGARKKEFRKLS Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 1 sequence  
Superfamily name : Rubredoxin-like Fold name : Rubredoxin-like No of Sequences : 1 Average size : 49