Tinnea zambesiaca                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : RuBisCO, large subunit, small (N-terminal) domain Fold name : Ferredoxin-like No of Sequences : 1 Average size : 133 Taxonomy       Alignment       Dendrogram Taxonomy [Help] superkingdom      Eukaryota kingdom      Viridiplantae phylum      Embryophyta order      Lamiales family      Lamiaceae genus      Tinnea Taxonomy       Alignment       Dendrogram Alignment [Help] 912532 KAYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSL 912532 DRYKGRCYNIEPVIGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLED 912532 LRIPVAYIKTFQ Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 1 sequence  
Superfamily name : RuBisCO, large subunit, small (N-terminal) domain Fold name : Ferredoxin-like No of Sequences : 1 Average size : 133