Tritirachium album                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : Protease propeptides/inhibitors Fold name : Ferredoxin-like No of Sequences : 2 Average size : 63 Diversity : 0.058326 Taxonomy       Alignment       Dendrogram Taxonomy [Help] superkingdom      Eukaryota kingdom      Fungi phylum      Ascomycota genus      Tritirachium Taxonomy       Alignment       Dendrogram Alignment [Help] 131077 KYIVKFKEGSALSALDAAMEKISGKPDHVYKNVFSGFAATLDENMVRVLRAHPDVIEQDA 131084 -YIVKLKEGSALASLDAAMEKLSGKADHVYKNIFKGFAASLDEKMVEVLRAHPDVEEQDA 131077 VVT 131084 IVN Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 2 sequence  
Superfamily name : Protease propeptides/inhibitors Fold name : Ferredoxin-like No of Sequences : 2 Average size : 63 Diversity : 0.058326