Thermus thermophilus                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : Glutamine synthetase, N-terminal domain Fold name : beta-Grasp (ubiquitin-like) No of Sequences : 1 Average size : 74 Taxonomy       Alignment       Dendrogram Taxonomy [Help] superkingdom      Bacteria phylum      Deinococcus-Thermus class      Deinococci order      Thermales family      Thermaceae genus      Thermus Taxonomy       Alignment       Dendrogram Alignment [Help] 46199267 ILKALKGENVKFLRLQITDILGVVKNVEVPESQFEKALDGEIMFDGSSIEGFTRIEES 46199267 MLLRPDYNTFVIL Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 1 sequence  
Superfamily name : Glutamine synthetase, N-terminal domain Fold name : beta-Grasp (ubiquitin-like) No of Sequences : 1 Average size : 74