Thermus thermophilus                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : Carbamoyl phosphate synthetase, small subunit N-terminal domain Fold name : The "swivelling" beta/beta/alpha domain No of Sequences : 1 Average size : 149 Taxonomy       Alignment       Dendrogram Taxonomy [Help] superkingdom      Bacteria phylum      Deinococcus-Thermus class      Deinococci order      Thermales family      Thermaceae genus      Thermus Taxonomy       Alignment       Dendrogram Alignment [Help] 46200008 AVLVLEDGTVYHGYAFGARGKTVGEVVFNTAQTGYQEIMTDPSYHGQIVVMTYPHQGNY 46200008 VNVYDMQSNRPWVRGFVAKEFSRVASNPRAQQTIGEFMEFYGVVGIEGIDTRALVRKIR 46200008 GGVLKGTIAHASLFGAPDHAFTQEELE Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 1 sequence  
Superfamily name : Carbamoyl phosphate synthetase, small subunit N-terminal domain Fold name : The "swivelling" beta/beta/alpha domain No of Sequences : 1 Average size : 149