Human papillomavirus type 25                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : E2 regulatory, transactivation domain Fold name : E2 regulatory, transactivation domain No of Sequences : 1 Average size : 217 Taxonomy       Alignment       Dendrogram Taxonomy [Help] family      Papillomaviridae genus      Papillomavirus Taxonomy       Alignment       Dendrogram Alignment [Help] 9627302 MENLSERFNVLQDQLMNIYETAAQTLEAQIEHWQILRREAVLLYFARQKGVTRLGYQPVP 9627302 ALMVSEAKAKEAIGMVLQLQSLQKSEFGKEPWSLVDTSTETYKSPPENHFKKGPMPIEVI 9627302 YDKDADNANAYTMWRYIYYVDDDDKWHKSASGVNHTGIYFMHGSFRHYYVLFADDARRYS 9627302 NTGHWEVKVNKDTVFTPVTSSTPPESPGGQADSNTS Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 1 sequence  
Superfamily name : E2 regulatory, transactivation domain Fold name : E2 regulatory, transactivation domain No of Sequences : 1 Average size : 217