Mesorhizobium loti                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : Ribosomal protein L25-like Fold name : Ribosomal protein L25-like No of Sequences : 1 Average size : 192 Taxonomy       Alignment       Dendrogram Taxonomy [Help] superkingdom      Bacteria phylum      Proteobacteria class      Alphaproteobacteria order      Rhizobiales family      Phyllobacteriaceae genus      Mesorhizobium Taxonomy       Alignment       Dendrogram Alignment [Help] 13472406 YELKAEAREQVGKGSARAVRRNGKVPAVIYGDKQPPLAIALTYKDIYYKIHGGGFLT 13472406 IATIDVDGKKIQVLPKDFQLDPVKDFPVHVDFLRIGKDTEVNVDVPVHFINEDKSPGI 13472406 RGGVLNIVRHEVEFHCPANAIPEFITIDLTGTNIGDSIHISAVQLPAGVKPVISDRDFT 13472406 ATIAGSSAMKPEA Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 1 sequence  
Superfamily name : Ribosomal protein L25-like Fold name : Ribosomal protein L25-like No of Sequences : 1 Average size : 192