Orchidantha siamensis                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : N-terminal domain of alpha and beta subunits of F1 ATP synthase Fold name : Domain of alpha and beta subunits of F1 ATP synthase-like No of Sequences : 1 Average size : 88 Taxonomy       Alignment       Dendrogram Taxonomy [Help] superkingdom      Eukaryota kingdom      Viridiplantae phylum      Embryophyta class      Liliopsida order      Zingiberales family      Lowiaceae genus      Orchidantha Taxonomy       Alignment       Dendrogram Alignment [Help] 5758902 VVSTLEEKNLGRIAQIIGPVLDVVFPPGKMPNIYNALVVKSRDTVGQQINVTCEVQQLLG 5758902 NNRVRAVAMSATDGLMRGMKVIDTGAP Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 1 sequence  
Superfamily name : N-terminal domain of alpha and beta subunits of F1 ATP synthase Fold name : Domain of alpha and beta subunits of F1 ATP synthase-like No of Sequences : 1 Average size : 88