Mesorhizobium loti                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : N-terminal domain of phosphatidylinositol transfer protein sec14p Fold name : RuvA C-terminal domain-like No of Sequences : 1 Average size : 58 Taxonomy       Alignment       Dendrogram Taxonomy [Help] superkingdom      Bacteria phylum      Proteobacteria class      Alphaproteobacteria order      Rhizobiales family      Phyllobacteriaceae genus      Mesorhizobium Taxonomy       Alignment       Dendrogram Alignment [Help] 13470732 REKALLAPYPGRVPPDVMDGTWKPPVTDGSGQDRKVLKAAFDLLKSIGYHVQDGTM Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 1 sequence  
Superfamily name : N-terminal domain of phosphatidylinositol transfer protein sec14p Fold name : RuvA C-terminal domain-like No of Sequences : 1 Average size : 58