Mycoplasma pulmonis                                  [NCBI]    [SCOP]     [PASS2] Superfamily name : C-terminal effector domain of the bipartite response regulators Fold name : DNA/RNA-binding 3-helical bundle No of Sequences : 2 Average size : 54 Diversity : 0.089422 Taxonomy       Alignment       Dendrogram Taxonomy [Help] superkingdom      Bacteria phylum      Firmicutes class      Mollicutes order      Mycoplasmatales family      Mycoplasmataceae genus      Mycoplasma Taxonomy       Alignment       Dendrogram Alignment [Help] 15828947 EIVYKIYGSSEFNLENKNKYVVYNKSFENKALWLIADLVQSKTKNIRHKLIDMVEQIIAN 15829144 -LLSK--GQ-KLTLE---LYLIEDLSMN-E----IADELSISKSAVHDSIKKGVQKL--- 15828947 TL 15829144 -- Identical Very similar Taxonomy       Alignment       Dendrogram Dendrogram [Help] Dendrogram not available for 2 sequence  
Superfamily name : C-terminal effector domain of the bipartite response regulators Fold name : DNA/RNA-binding 3-helical bundle No of Sequences : 2 Average size : 54 Diversity : 0.089422