Home
About pass2
Superfamily list
Align query
Useful tools
Search
Help
Lab page
Protein Alignments organised as Structural Superfamilies


Superfamily :     Cell division protein MinE topological specificity domain
Class :    Alpha and beta proteins (a+b)
Fold :    Cell division protein MinE topological specificity domain
Number of Members :     1
Average Size :     58


Alignment Genome Distribution HMM Interacting Motifs

Protein
Code		 Start
Residue		 Start
Chain		 End
Residue		 End
Chain		 Domain
Size		 Name Source Resolution R-factor
1ev0a- 31 A 88 A 58 mine escherichia coli --- ---

| pir | postscript | superposed-coordinates |

Alignment Based On Similarities In Structural Features (COMPARER Alignment) 



 
1ev0a-  (  31 )    rsdaephylpqlrkdilevickyvqidpemvtvqleqkdgdisilelnvt
                    333    aaaaaaaaaaaaaaa    333bbbbbbbb   bbbbbbbb 
 


    
1ev0a-  (  81 )    lpeaeelk
                           
 


    
 


Key
solvent inaccessible                    UPPER CASE      X
solvent accesible                       lower case      x
alpha helix                             red             x
beta strand				blue            x
3 - 10 helix				maroon          x
hydrogen bond to main chain amide    	bold            x
hydrogen bond to mainchain carbonyl     underline	x
disulphide bond                         cedilla         ç
positive phi				italic		x


  Enter Search key:




 
Your suggestions and further clarifications are most welcome.

-contact mini@ncbs.res.in