Home Browse SearchHelp Group

3dswap- Curated Knowledgebase of 3D domains swapping in Proteins:

FASTA format description (Input in BLAST search)

A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column.

Examples:

>11BA_A
KESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRKMTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQS
KSTMRITDCRETGSSKYPNCAYKTTQVEKHIIVACGGKPSVPVHFDASV

>1E7D_A
MLLTGKLYKEEKQKFYDAQNGKCLICQRELNPDVQANHLDHDHELNGPKAGKVRGLLCNLCNAAEGQMKHKFNRS
GLKGQGVDYLEWLENLLTYLKSDYTQNNIHPNFVGDKSKEFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKK
QLRKSLK

>1BH5:D|PDBID|CHAIN|SEQUENCE
AEPQPPSGGLTDEAALSCCSDADPSTKDFLLQETMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDI
PKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGL
AFIQDPDGYWIQILNPNKMATLM

>d1a26a1
KSKLAKPIQDLIKMIFDVESMKKAMVEFEIDLQKMPLGKLSKRQIQSAYSILNEVQQAVS
DGGSESQILDLSNRFYTLIPHDFGMKKPPLLSNLEYIQAKVQMLDNLLDIEVAYSLLRGG
NEDGDKDPIDINYEK

>d1diva1
RQAAEELANAKKLKEQLEKLTVTIPAKAGEGGRLFGSITSKQIAESLQAQHGLKLDKRKI
ELADAIRALGYTNVPVKLHPEVTATLKVHVTEQK

Example 6:
>d1duvg1
SGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEAKLTGKNIALIFEKDSTRTRC
SFEVAAYDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEYA
SVPVWNGLTNEFHPTQLLADLLTMQEHLPG

Sequences are expected to be represented in the standard IUB/IUPAC amino acid single code in single letter (see below). Before submitting a request, any numerical digits in the query sequence should be removed. 3DSwap - BLAST accept the following 20 amino acid codes in FASTA Format:

Alanine  	Ala  	A
Arginine  	Arg  	R
Aspartic Acid  	Asp  	D
Asparagine  	Asn  	N
Cysteine  	Cys  	C
Glutamic Acid  	Glu  	E
Glutamine  	Gln  	Q
Glycine  	Gly  	G
Histidine  	His  	H
Isoleucine  	Ile  	I
Leucine  	Leu  	L
Lysine  	Lys  	K
Methionine  	Met  	M
Phenylalanine  	Phe  	F
Proline  	Pro  	P
Serine  	Ser  	S
Threonine  	Thr  	T
Tryptophan  	Trp  	W
Tyrosine  	Tyr  	Y
Valine  	Val  	V

Contact:
Prof. R. Sowdhamini (Contact : mini@ncbs.res.in)